• Gene id: 170082

Gene Summary

• Gene Symbol: TCEANC   Gene   UCSC   Ensembl
• Gene name: transcription elongation factor A N-terminal and central domain containing
• Alternate names: transcription elongation factor A N-terminal and central domain-containing protein, TFIIS central domain-containing protein 1, TFS2-M domain-containing protein 1, transcription elongation factor A (SII) N-terminal and central domain containing,
• Gene location: Xp22.2 (13653109: 13665408)     Exons: 5     NC_000023.11
• OMIM: 0

Protein Summary

• Protein general information: Q8N8B7  
  • Name: Transcription elongation factor A N terminal and central domain containing protein (TFIIS central domain containing protein 1)
  • Length: 351  
  • Mass: 40245
• Sequence:

  MSDKNQIAARASLIEQLMSKRNFEDLGNHLTELETIYVTKEHLQETDVVRAVYRVLKNCPSVALKKKAKCLLSKW
  KAVYKQTHSKARNSPKLFPVRGNKEENSGPSHDPSQNETLGICSSNSLSSQDVAKLSEMIVPENRAIQLKPKEEH
  FGDGDPESTGKRSSELLDPTTPMRTKCIELLYAALTSSSTDQPKADLWQNFAREIEEHVFTLYSKNIKKYKTCIR
  SKVANLKNPRNSHLQQNLLSGTTSPREFAEMTVMEMANKELKQLRASYTESCIQEHYLPQVIDGTQTNKIKCRRC
  EKYNCKVTVIDRGTLFLPSWVRNSNPDEQMMTYVICNECGEQWYHSKWVCW

• Structural information:
  • Protein Domains: (5..8-)
    (/note="TFIIS-N-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00649-)
    (173..28-)
    (/note="TFIIS-central)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00651"-)
  • Interpro: IPR035100  IPR035441  IPR003618  IPR036575  IPR017923  
  • Prosite: PS51321 PS51319
  • STRING: ENSP00000440038
• Other Databases: GeneCards:  TCEANC  Malacards:  TCEANC

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IEA	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)