• Gene id: 169966

Gene Summary

• Gene Symbol: TENT5D   Gene   UCSC   Ensembl
• Aliases: CT1.26, CT112, FAM46D
• Gene name: terminal nucleotidyltransferase 5D
• Alternate names: terminal nucleotidyltransferase 5D, cancer/testis antigen 112, family with sequence similarity 46 member D, non-canonical poly(A) polymerase FAM46D, protein FAM46D, putative nucleotidyltransferase FAM46D,
• Gene location: Xq21.1 (80335438: 80446884)     Exons: 5     NC_000023.11
• Gene summary(Entrez): Antibodies against the protein encoded by this gene were found only in plasma from cancer patients. While it may be a target for immunotherapy, the function of this gene is unknown. [provided by RefSeq, Dec 2009]
• OMIM: 0

Protein Summary

• Protein general information: Q8NEK8  
  • Name: Terminal nucleotidyltransferase 5D (EC 2.7.7.19) (Non canonical poly(A) polymerase FAM46D)
  • Length: 389  
  • Mass: 44500
  • Tissue specificity: restricted to testis. {ECO
• Sequence:

  MSEIRFTNLTWDQVITLDQVLDEVIPIHGKGNFPTMEVKPKDIIHVVKDQLIGQGIIVKDARLNGSVASYILASH
  NGISYKDLDVIFGVELPGNEEFQVVKDAVLDCLLDFLPKDVKKEKLSPDIMKDAYVQKLVKVCNGHDCWSLISLS
  NNTGKNLELKFVSSLRRQFEFSVDSFQIVLDPMLDFYSDKNAKLTKESYPVVVAESMYGDFQEAMTHLQHKLICT
  RKPEEIRGGGLLKYCSLLVHGFKPACMSEIKNLERYMCSRFFIDFPHIEEQQKKIESYLHNHFIGEGMTKYDYLM
  TLHGVVNESTVCLMSYERRQILHLITMMALKVLGELNILPNTQKVTCFYQPAPYFAAEARYPIYVIPEPPPVSFQ
  PYHPLHFRGSNGMS

• Structural information:
  • Interpro: IPR012937  
  • STRING: ENSP00000443410
• Other Databases: GeneCards:  TENT5D  Malacards:  TENT5D

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016779	nucleotidyltransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0004652	polynucleotide adenylyltransferase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1990817	RNA adenylyltransferase activity	IBA	molecular function
GO:0048255	mRNA stabilization	IBA	biological process
GO:1990817	RNA adenylyltransferase activity	IDA	molecular function
GO:1990817	RNA adenylyltransferase activity	IEA	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)