• Gene id: 169355

Gene Summary

• Gene Symbol: IDO2   Gene   UCSC   Ensembl
• Aliases: INDOL1
• Gene name: indoleamine 2,3-dioxygenase 2
• Alternate names: indoleamine 2,3-dioxygenase 2, IDO-2, indoleamine 2,3-dioxygenase-like 1 protein, indoleamine 2,3-dioxygenase-like protein 1, indoleamine-pyrrole 2,3 dioxygenase-like 1, indoleamine-pyrrole 2,3-dioxygenase-like protein 1,
• Gene location: 8p11.21 (138594382: 138494338)     Exons: 24     NC_000003.12
• Gene summary(Entrez): Along with the enzymes encoded by the INDO (MIM 147435) and TDO2 (MIM 191070) genes, the enzyme encoded by the INDOL1 gene metabolizes tryptophan in the kynurenine pathway (Ball et al., 2007 [PubMed 17499941]).[supplied by OMIM, Feb 2011]
• OMIM: 612129

Protein Summary

• Protein general information: Q6ZQW0  
  • Name: Indoleamine 2,3 dioxygenase 2 (IDO 2) (EC 1.13.11. ) (Indoleamine 2,3 dioxygenase like protein 1) (Indoleamine pyrrole 2,3 dioxygenase like protein 1)
  • Length: 420  
  • Mass: 47075
  • Tissue specificity: Detected in liver, small intestine, spleen, placenta, thymus, lung, brain, kidney, and colon (PubMed
• Sequence:

  MLHFHYYDTSNKIMEPHRPNVKTAVPLSLESYHISEEYGFLLPDSLKELPDHYRPWMEIANKLPQLIDAHQLQAH
  VDKMPLLSCQFLKGHREQRLAHLVLSFLTMGYVWQEGEAQPAEVLPRNLALPFVEVSRNLGLPPILVHSDLVLTN
  WTKKDPDGFLEIGNLETIISFPGGESLHGFILVTALVEKEAVPGIKALVQATNAILQPNQEALLQALQRLRLSIQ
  DITKTLGQMHDYVDPDIFYAGIRIFLSGWKDNPAMPAGLMYEGVSQEPLKYSGGSAAQSTVLHAFDEFLGIRHSK
  ESGDFLYRMRDYMPPSHKAFIEDIHSAPSLRDYILSSGQDHLLTAYNQCVQALAELRSYHITMVTKYLITAAAKA
  KHGKPNHLPGPPQALKDRGTGGTAVMSFLKSVRDKTLESILHPRG

• Structural information:
  • Interpro: IPR000898  IPR037217  
  • STRING: ENSP00000443432
• Other Databases: GeneCards:  IDO2  Malacards:  IDO2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004833	tryptophan 2,3-dioxygenase activity	IBA	molecular function
GO:0019441	tryptophan catabolic process to kynurenine	IBA	biological process
GO:0033754	indoleamine 2,3-dioxygenase activity	IBA	molecular function
GO:0034354	'de novo' NAD biosynthetic process from tryptophan	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0019441	tryptophan catabolic process to kynurenine	IEA	biological process
GO:0020037	heme binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0006569	tryptophan catabolic process	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0051213	dioxygenase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0006569	tryptophan catabolic process	TAS	biological process
GO:0033754	indoleamine 2,3-dioxygenase activity	IEA	molecular function
GO:0019441	tryptophan catabolic process to kynurenine	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0019441	tryptophan catabolic process to kynurenine	IEA	biological process
GO:0033754	indoleamine 2,3-dioxygenase activity	IDA	molecular function
GO:0019441	tryptophan catabolic process to kynurenine	IDA	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0033754	indoleamine 2,3-dioxygenase activity	ISS	molecular function
GO:0019441	tryptophan catabolic process to kynurenine	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00380	Tryptophan metabolism
hsa05143	African trypanosomiasis

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq