• Gene id: 169026

Gene Summary

• Gene Symbol: SLC30A8   Gene   UCSC   Ensembl
• Aliases: ZNT8, ZnT-8
• Gene name: solute carrier family 30 member 8
• Alternate names: zinc transporter 8, solute carrier family 30 (zinc transporter), member 8, zinc transporter ZnT-8,
• Gene location: 8q24.11 (116950216: 117176713)     Exons: 13     NC_000008.11
• Gene summary(Entrez): The protein encoded by this gene is a zinc efflux transporter involved in the accumulation of zinc in intracellular vesicles. This gene is expressed at a high level only in the pancreas, particularly in islets of Langerhans. The encoded protein colocalize
• OMIM: 611145

Protein Summary

• Protein general information: Q8IWU4  
  • Name: Zinc transporter 8 (ZnT 8) (Solute carrier family 30 member 8)
  • Length: 369  
  • Mass: 40755
  • Tissue specificity: In the endocrine pancreas, expressed in insulin-producing beta cells. Expressed at relatively high levels in subcutaneous fat tissue from lean persons; much lower levels in visceral fat, whether from lean or obese individuals, and in s
• Sequence:

  MEFLERTYLVNDKAAKMYAFTLESVELQQKPVNKDQCPRERPEELESGGMYHCHSGSKPTEKGANEYAYAKWKLC
  SASAICFIFMIAEVVGGHIAGSLAVVTDAAHLLIDLTSFLLSLFSLWLSSKPPSKRLTFGWHRAEILGALLSILC
  IWVVTGVLVYLACERLLYPDYQIQATVMIIVSSCAVAANIVLTVVLHQRCLGHNHKEVQANASVRAAFVHALGDL
  FQSISVLISALIIYFKPEYKIADPICTFIFSILVLASTITILKDFSILLMEGVPKSLNYSGVKELILAVDGVLSV
  HSLHIWSLTMNQVILSAHVATAASRDSQVVRREIAKALSKSFTMHSLTIQMESPVDQDPDCLFCEDPCD

• Structural information:
  • Interpro: IPR002524  IPR036837  IPR027469  IPR033572  
  • STRING: ENSP00000415011
• Other Databases: GeneCards:  SLC30A8  Malacards:  SLC30A8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IBA	cellular component
GO:0005385	zinc ion transmembrane transporter activity	IBA	molecular function
GO:0009749	response to glucose	IBA	biological process
GO:0010043	response to zinc ion	IBA	biological process
GO:0030073	insulin secretion	IBA	biological process
GO:0061088	regulation of sequestering of zinc ion	IBA	biological process
GO:0071577	zinc ion transmembrane transport	IBA	biological process
GO:0005385	zinc ion transmembrane transporter activity	IEA	molecular function
GO:0006812	cation transport	IEA	biological process
GO:0006882	cellular zinc ion homeostasis	IEA	biological process
GO:0008324	cation transmembrane transporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006829	zinc ion transport	IEA	biological process
GO:0006811	ion transport	IEA	biological process
GO:0030667	secretory granule membrane	TAS	cellular component
GO:0005385	zinc ion transmembrane transporter activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032024	positive regulation of insulin secretion	IEA	biological process
GO:0009749	response to glucose	IEA	biological process
GO:0006882	cellular zinc ion homeostasis	IEA	biological process
GO:0070555	response to interleukin-1	IEA	biological process
GO:0061088	regulation of sequestering of zinc ion	IEA	biological process
GO:0060627	regulation of vesicle-mediated transport	IEA	biological process
GO:0034341	response to interferon-gamma	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0030073	insulin secretion	IEA	biological process
GO:0042803	protein homodimerization activity	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0030073	insulin secretion	IEA	biological process
GO:0009749	response to glucose	IEA	biological process
GO:0006882	cellular zinc ion homeostasis	IEA	biological process
GO:0005385	zinc ion transmembrane transporter activity	IDA	molecular function
GO:0008270	zinc ion binding	IC	molecular function
GO:0042803	protein homodimerization activity	ISS	molecular function
GO:0005794	Golgi apparatus	IDA	NOT|cellular component
GO:0030141	secretory granule	IDA	cellular component
GO:0032119	sequestering of zinc ion	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0006829	zinc ion transport	IDA	biological process
GO:0006882	cellular zinc ion homeostasis	ISS	biological process
GO:0006882	cellular zinc ion homeostasis	ISS	biological process
GO:0009749	response to glucose	IMP	biological process
GO:0031410	cytoplasmic vesicle	ISS	cellular component
GO:0030073	insulin secretion	IMP	biological process
GO:0042593	glucose homeostasis	ISS	NOT|biological process
GO:0060627	regulation of vesicle-mediated transport	ISS	biological process
GO:0061088	regulation of sequestering of zinc ion	ISS	biological process
GO:0032024	positive regulation of insulin secretion	ISS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0030658	transport vesicle membrane	IEA	cellular component

Diseases

Associated diseases	References
Type 2 diabetes mellitus	KEGG:H00409
Type 2 diabetes mellitus	KEGG:H00409
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)