About Us

Search Result


Gene id 168544
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol ZNF467   Gene   UCSC   Ensembl
Aliases EZI, Zfp467
Gene name zinc finger protein 467
Alternate names zinc finger protein 467, zinc finger protein EZI,
Gene location 7q36.1 (149776322: 149764181)     Exons: 9     NC_000007.14
Gene summary(Entrez) The protein encoded by this gene is a zinc finger protein whose function has not yet been elucidated in humans. However, the mouse ortholog of this protein enhances adipocyte differentiation and suppresses osteoblast differentiation in bone marrow. The mo
OMIM 179610

Protein Summary

Protein general information Q7Z7K2  

Name: Zinc finger protein 467

Length: 595  Mass: 65124

Sequence MRETLEALSSLGFSVGQPEMAPQSEPREGSHNAQEQMSSSREERALGVCSGHEAPTPEEGAHTEQAEAPCRGQAC
SAQKAQPVGTCPGEEWMIRKVKVEDEDQEAEEEVEWPQHLSLLPSPFPAPDLGHLAAAYKLEPGAPGALSGLALS
GWGPMPEKPYGCGECERRFRDQLTLRLHQRLHRGEGPCACPDCGRSFTQRAHMLLHQRSHRGERPFPCSECDKRF
SKKAHLTRHLRTHTGERPYPCAECGKRFSQKIHLGSHQKTHTGERPFPCTECEKRFRKKTHLIRHQRIHTGERPY
QCAQCARSFTHKQHLVRHQRVHQTAGPARPSPDSSASPHSTAPSPTPSFPGPKPFACSDCGLSFGWKKNLATHQC
LHRSEGRPFGCDECALGATVDAPAAKPLASAPGGPGCGPGSDPVVPQRAPSGERSFFCPDCGRGFSHGQHLARHP
RVHTGERPFACTQCDRRFGSRPNLVAHSRAHSGARPFACAQCGRRFSRKSHLGRHQAVHTGSRPHACAVCARSFS
SKTNLVRHQAIHTGSRPFSCPQCGKSFSRKTHLVRHQLIHGEAAHAAPDAALAAPAWSAPPEVAPPPLFF
Structural information
Interpro:  IPR036236  IPR013087  
Prosite:   PS00028 PS50157
STRING:   ENSP00000304769
Other Databases GeneCards:  ZNF467  Malacards:  ZNF467

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0046872 metal ion binding
IEA molecular function
GO:0005634 nucleus
IEA cellular component
GO:0003677 DNA binding
IEA molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0006355 regulation of transcripti
on, DNA-templated
IEA biological process
GO:0005634 nucleus
IEA cellular component
GO:0003677 DNA binding
IEA molecular function
GO:0005634 nucleus
IEA cellular component
GO:0046872 metal ion binding
IEA molecular function
GO:0005634 nucleus
IEA cellular component
GO:0003677 DNA binding
IEA molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0006355 regulation of transcripti
on, DNA-templated
IEA biological process
GO:0005634 nucleus
IEA cellular component
GO:0003677 DNA binding
IEA molecular function
GO:0005634 nucleus
IEA cellular component
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm

18
Male infertility GSE26881
Show abstract