• Gene id: 168537

Gene Summary

• Gene Symbol: GIMAP7   Gene   UCSC   Ensembl
• Aliases: IAN7, hIAN7
• Gene name: GTPase, IMAP family member 7
• Alternate names: GTPase IMAP family member 7, IAN-7, immune associated nucleotide, immune-associated nucleotide-binding protein 7, immunity-associated nucleotide 7 protein,
• Gene location: 7q36.1 (150514871: 150521072)     Exons: 2     NC_000007.14
• Gene summary(Entrez): This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, the IAN subfamily genes are located in a cluster at 7q36.1. [provided by RefSeq, Jul 20
• OMIM: 607610

Protein Summary

• Protein general information: Q8NHV1  
  • Name: GTPase IMAP family member 7 (Immunity associated nucleotide 7 protein) (IAN 7)
  • Length: 300  
  • Mass: 34509
  • Tissue specificity: Most abundantly expressed in spleen, lymph nodes, and fetal kidney, but also present in the heart and the small intestine. Lower expression levels are found in lung, kidney, liver, and thyroid, salivary, and mammary glands. Also detect
• Sequence:

  MAESEDRSLRIVLVGKTGSGKSATANTILGEEIFDSRIAAQAVTKNCQKASREWQGRDLLVVDTPGLFDTKESLD
  TTCKEISRCIISSCPGPHAIVLVLLLGRYTEEEQKTVALIKAVFGKSAMKHMVILFTRKEELEGQSFHDFIADAD
  VGLKSIVKECGNRCCAFSNSKKTSKAEKESQVQELVELIEKMVQCNEGAYFSDDIYKDTEERLKQREEVLRKIYT
  DQLNEEIKLVEEDKHKSEEEKEKEIKLLKLKYDEKIKNIREEAERNIFKDVFNRIWKMLSEIWHRFLSKCKFYSS

• Structural information:
  • Protein Domains: (6..21-)
    (/note="AIG1-type-G")
  • Interpro: IPR006703  IPR027417  
  • Prosite: PS51720
  • PDB: 3ZJC
  • PDBsum: 3ZJC
  • DIP: 60142
  • STRING: ENSP00000315474
• Other Databases: GeneCards:  GIMAP7  Malacards:  GIMAP7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IBA	cellular component
GO:0005811	lipid droplet	IDA	cellular component
GO:0005525	GTP binding	IDA	molecular function
GO:0003924	GTPase activity	IDA	molecular function
GO:0046039	GTP metabolic process	IDA	biological process
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005811	lipid droplet	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005811	lipid droplet	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray