• Gene id: 168451

Gene Summary

• Gene Symbol: THAP5   Gene   UCSC   Ensembl
• Gene name: THAP domain containing 5
• Alternate names: THAP domain-containing protein 5,
• Gene location: 7q31.1 (108569767: 108562131)     Exons: 4     NC_000007.14
• OMIM: 612534

Protein Summary

• Protein general information: Q7Z6K1  
  • Name: THAP domain containing protein 5
  • Length: 395  
  • Mass: 45416
  • Tissue specificity: Detected in heart (PubMed
• Sequence:

  MPRYCAAICCKNRRGRNNKDRKLSFYPFPLHDKERLEKWLKNMKRDSWVPSKYQFLCSDHFTPDSLDIRWGIRYL
  KQTAVPTIFSLPEDNQGKDPSKKKSQKKNLEDEKEVCPKAKSEESFVLNETKKNIVNTDVPHQHPELLHSSSLVK
  PPAPKTGSIQNNMLTLNLVKQHTGKPESTLETSVNQDTGRGGFHTCFENLNSTTITLTTSNSESIHQSLETQEVL
  EVTTSHLANPNFTSNSMEIKSAQENPFLFSTINQTVEELNTNKESVIAIFVPAENSKPSVNSFISAQKETTEMED
  TDIEDSLYKDVDYGTEVLQIEHSYCRQDINKEHLWQKVSKLHSKITLLELKEQQTLGRLKSLEALIRQLKQENWL
  SEENVKIIENHFTTYEVTMI

• Structural information:
  • Interpro: IPR006612  IPR038441  
  • Prosite: PS50950
  • STRING: ENSP00000400500
• Other Databases: GeneCards:  THAP5  Malacards:  THAP5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0045786	negative regulation of cell cycle	IMP	biological process
GO:0002020	protease binding	IPI	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)