• Gene id: 168433

Gene Summary

• Gene Symbol: RNF133   Gene   UCSC   Ensembl
• Gene name: ring finger protein 133
• Alternate names: E3 ubiquitin-protein ligase RNF133, RING-type E3 ubiquitin transferase RNF133,
• Gene location: 7q31.32 (122699116: 122697734)     Exons: 1     NC_000007.14
• Gene summary(Entrez): The protein encoded by this gene contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. This gene has no intron. [provided by RefSeq, Jul 2008
• OMIM: 603582

Protein Summary

• Protein general information: Q8WVZ7  
  • Name: E3 ubiquitin protein ligase RNF133 (EC 2.3.2.27) (RING finger protein 133) (RING type E3 ubiquitin transferase RNF133)
  • Length: 376  
  • Mass: 42294
• Sequence:

  MHLLKVGTWRNNTASSWLMKFSVLWLVSQNCCRASVVWMAYMNISFHVGNHVLSELGETGVFGRSSTLKRVAGVI
  VPPEGKIQNACNPNTIFSRSKYSETWLALIERGGCTFTQKIKVATEKGASGVIIYNVPGTGNQVFPMFHQAFEDV
  VVVMIGNLKGTEIFHLIKKGVLITAVVEVGRKHIIWMNHYLVSFVIVTTATLAYFIFYHIHRLCLARIQNRRWQR
  LTTDLQNTFGQLQLRVVKEGDEEINPNGDSCVICFERYKPNDIVRILTCKHFFHKNCIDPWILPHGTCPICKCDI
  LKVLGIQVVVENGTEPLQVLMSNELPETLSPSEEETNNEVSPAGTSDKVIHVEENPTSQNNDIQPHSVVEDVHPS
  P

• Structural information:
  • Protein Domains: (65..16-)
    (/note="PA"-)
  • Interpro: IPR003137  IPR001841  IPR013083  
  • Prosite: PS50089
  • STRING: ENSP00000344489
• Other Databases: GeneCards:  RNF133  Malacards:  RNF133

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005770	late endosome	IBA	cellular component
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0005789	endoplasmic reticulum membrane	IBA	cellular component
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0006511	ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0051865	protein autoubiquitination	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881