• Gene id: 168400

Gene Summary

• Gene Symbol: DDX53   Gene   UCSC   Ensembl
• Aliases: CAGE, CT26
• Gene name: DEAD-box helicase 53
• Alternate names: DEAD box protein 53, DEAD (Asp-Glu-Ala-Asp) box polypeptide 53, DEAD-box protein CAGE, cancer-associated gene protein, cancer/testis antigen 26, probable ATP-dependent RNA helicase DDX53,
• Gene location: Xp22.11 (22999959: 23003588)     Exons: 1     NC_000023.11
• Gene summary(Entrez): This intronless gene encodes a protein which contains several domains found in members of the DEAD-box helicase protein family. Other members of this protein family participate in ATP-dependent RNA unwinding. [provided by RefSeq, Sep 2011]
• OMIM: 0

Protein Summary

• Protein general information: Q86TM3  
  • Name: Probable ATP dependent RNA helicase DDX53 (EC 3.6.4.13) (Cancer associated gene protein) (Cancer/testis antigen 26) (CT26) (DEAD box protein 53) (DEAD box protein CAGE)
  • Length: 631  
  • Mass: 71154
  • Tissue specificity: Expressed in testis. Wide expression in various cancer tissues and cancer cell lines. {ECO
• Sequence:

  MSHWAPEWKRAEANPRDLGASWDVRGSRGSGWSGPFGHQGPRAAGSREPPLCFKIKNNMVGVVIGYSGSKIKDLQ
  HSTNTKIQIINGESEAKVRIFGNREMKAKAKAAIETLIRKQESYNSESSVDNAASQTPIGRNLGRNDIVGEAEPL
  SNWDRIRAAVVECEKRKWADLPPVKKNFYIESKATSCMSEMQVINWRKENFNITCDDLKSGEKRLIPKPTCRFKD
  AFQQYPDLLKSIIRVGIVKPTPIQSQAWPIILQGIDLIVVAQTGTGKTLSYLMPGFIHLDSQPISREQRNGPGML
  VLTPTRELALHVEAECSKYSYKGLKSICIYGGRNRNGQIEDISKGVDIIIATPGRLNDLQMNNSVNLRSITYLVI
  DEADKMLDMEFEPQIRKILLDVRPDRQTVMTSATWPDTVRQLALSYLKDPMIVYVGNLNLVAVNTVKQNIIVTTE
  KEKRALTQEFVENMSPNDKVIMFVSQKHIADDLSSDFNIQGISAESLHGNSEQSDQERAVEDFKSGNIKILITTD
  IVSRGLDLNDVTHVYNYDFPRNIDVYVHRVGYIGRTGKTGTSVTLITQRDSKMAGELIKILDRANQSVPEDLVVM
  AEQYKLNQQKRHRETRSRKPGQRRKEFYFLS

• Structural information:
  • Protein Domains: (48..10-)
    (/note="KH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00117-)
    (253..42-)
    (/note="Helicase-ATP-binding)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00541-)
    (440..60-)
    (/note="Helicase-C-terminal)
    (/evidence="ECO:0000255|PROSI-)
  • Interpro: IPR011545  IPR014001  IPR001650  IPR004087  IPR004088   IPR036612  IPR027417  IPR000629  IPR014014  
  • Prosite: PS00039 PS51192 PS51194 PS50084 PS51195
  • PDB: 3IUY
  • PDBsum: 3IUY
  • STRING: ENSP00000368667
• Other Databases: GeneCards:  DDX53  Malacards:  DDX53

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1990904	ribonucleoprotein complex	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0003724	RNA helicase activity	IBA	molecular function
GO:0003723	RNA binding	IBA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004386	helicase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0003724	RNA helicase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)