• Gene id: 168391

Gene Summary

• Gene Symbol: GALNTL5   Gene   UCSC   Ensembl
• Aliases: GALNACT19, GALNT15, GalNAc-T5L
• Gene name: polypeptide N-acetylgalactosaminyltransferase like 5
• Alternate names: inactive polypeptide N-acetylgalactosaminyltransferase-like protein 5, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 15, UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 5, galNAc-T15, polypeptide GalNAc tra,
• Gene location: 7q36.1 (151956378: 152019933)     Exons: 16     NC_000007.14
• OMIM: 615133

Protein Summary

• Protein general information: Q7Z4T8  
  • Name: Inactive polypeptide N acetylgalactosaminyltransferase like protein 5 (Polypeptide GalNAc transferase 15) (GalNAc T15) (pp GaNTase 15) (Protein UDP acetylgalactosaminyltransferase 15) (UDP GalNAc:polypeptide N acetylgalactosaminyltransferase 15)
  • Length: 443  
  • Mass: 51,427
• Sequence:

  MRNAIIQGLFYGSLTFGIWTALLFIYLHHNHVSSWQKKSQEPLSAWSPGKKVHQQIIYGSEQIPKPHVIVKRTDE
  DKAKSMLGTDFNHTNPELHKELLKYGFNVIISRSLGIEREVPDTRSKMCLQKHYPARLPTASIVICFYNEECNAL
  FQTMSSVTNLTPHYFLEEIILVDDMSKVDDLKEKLDYHLETFRGKVKIIRNKKREGLIRARLIGASHASGDVLVF
  LDSHCEVNRVWLEPLLHAIAKDPKMVVCPLIDVIDDRTLEYKPSPLVRGTFDWNLQFKWDNVFSYEMDGPEGSTK
  PIRSPAMSGGIFAIRRHYFNEIGQYDKDMDFWGRENLELSLRIWMCGGQLFIIPCSRVGHISKKQTGKPSTIISA
  MTHNYLRLVHVWLDEYKEQFFLRKPGLKYVTYGNIRERVELRKRLGCKSFQWYLDNVFPELEASVNSL

• Structural information:
  • Interpro: IPR001173  IPR029044  
  • STRING: ENSP00000376548
• Other Databases: GeneCards:  GALNTL5  Malacards:  GALNTL5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007286	spermatid development	IMP	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0031902	late endosome membrane	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0006486	protein glycosylation	IDA	biological process
GO:0016757	transferase activity, transferring glycosyl groups	IDA	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0007283	spermatogenesis	IEA	biological process
GO:0007286	spermatid development	IEA	biological process
GO:0007286	spermatid development	IMP	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0031902	late endosome membrane	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0006486	protein glycosylation	IDA	biological process
GO:0016757	transferase activity, transferring glycosyl groups	IDA	molecular function
GO:0007286	spermatid development	IMP	biological process
GO:0006486	protein glycosylation	IDA	biological process
GO:0016757	transferase activity, transferring glycosyl groups	IDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways

Diseases

Associated diseases	References
Sperm motility	MIK: 24398516
Male factor infertility	MIK: 24398516
Asthenozoospermia	MIK: 24398516
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Asthenoozoospermia	MIK: 30628500
Male infertility	MIK: 24398516
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24398516	Male infertility, sperm motility, asthenozoospermia	Deletion of T at position 764		1 patient with asthenozoospermia	Male infertility
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
30628500	Asthenoozoospermia				Male infertility