• Gene id: 168002

Gene Summary

• Gene Symbol: DACT2   Gene   UCSC   Ensembl
• Aliases: C6orf116, DAPPER2, DPR2, bA503C24.7
• Gene name: dishevelled binding antagonist of beta catenin 2
• Alternate names: dapper homolog 2, dapper antagonist of catenin 2, dapper homolog 2, antagonist of beta-catenin, dapper, antagonist of beta-catenin, homolog 2,
• Gene location: 6q27 (168319776: 168292829)     Exons: 8     NC_000006.12

Protein Summary

• Protein general information: Q5SW24  
  • Name: Dapper homolog 2 (Dapper antagonist of catenin 2)
  • Length: 774  
  • Mass: 82700
• Sequence:

  MWTPGGPPGSAGWDRRRLGARLRAAFAGLQELQGLRATQQERVRGALALQPPPAPAAPCGPHGLHGPEQQLEAAL
  AALQEQLSRLRQQDIGLKTHLDQLDLQISKLQLDVGTASGEALDSDSRPSSGFYEMSDGGSCSLSTSCASVCSDH
  ISPSLGSLLPVAQAHKARPSMGDWRPRSVDETTVPAWRPQATEEGARPPGSVEDAGQPWGTFWPRPVSTGDLDRA
  LPADTGLQKASADAELLGLLCQGVDIPLHVPDPKYRQDLVSQGGREVYPYPSPLHAVALQSPLFVLTKETPQRGG
  PSFPRESPRGPAGLNTIQTGPVLEAGPARARAYIDRLLHLWGRETPAKGSEGEQGPLRHAASPSPQRQGGWSTDG
  GGRLLVFAPGREDEGGPAQSRGAGRGGPQQQGYMPLEGPQQSGSLPEEGSKPSNSCVLRETMVQASPSSKAQQTP
  SAQDYGRGNIISPSRMLDKSPSPASGHFAHPSFAASLKMGPPKSKAEKIKRSPMDKVLRFARQPLLLLDRPEGAH
  AAPQPSLEWDPAHWPTGRGGLQRRPALAWEAPGRSCSESTLYPMPVLVPLAVAPQESHRTSAQALFPFEASLLTS
  VARRKHRRWQSTVEISARARLASCPESNLGPPRPVARRAGGPLARGRPSLVRQDAYTRSDSEPSKHSAECDPRFP
  SVIPETSEGESSDHTTNRFGDRESSSSDEEGGAQSRDCDLALGYVAAGHAELAWTQEAPVSSGPLLSPVPKLCRI
  KASKALKKKIRRFQPTALKVMTMV

• Structural information:
  • Interpro: IPR024853  IPR024843  
  • STRING: ENSP00000355760
• Other Databases: GeneCards:  DACT2  Malacards:  DACT2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:1900108	negative regulation of nodal signaling pathway	IBA	biological process
GO:1900108	negative regulation of nodal signaling pathway	ISS	biological process
GO:0051018	protein kinase A binding	ISS	molecular function
GO:0008013	beta-catenin binding	ISS	molecular function
GO:0005080	protein kinase C binding	ISS	molecular function
GO:0072061	inner medullary collecting duct development	ISS	biological process
GO:0070097	delta-catenin binding	ISS	molecular function
GO:0043588	skin development	ISS	biological process
GO:0008134	transcription factor binding	ISS	molecular function
GO:0007162	negative regulation of cell adhesion	ISS	biological process
GO:0003382	epithelial cell morphogenesis	ISS	biological process
GO:1900108	negative regulation of nodal signaling pathway	IEA	biological process
GO:0051018	protein kinase A binding	IEA	molecular function
GO:0008013	beta-catenin binding	IEA	molecular function
GO:0005080	protein kinase C binding	IEA	molecular function
GO:0072061	inner medullary collecting duct development	IEA	biological process
GO:0070097	delta-catenin binding	IEA	molecular function
GO:0043588	skin development	IEA	biological process
GO:0008134	transcription factor binding	IEA	molecular function
GO:0007162	negative regulation of cell adhesion	IEA	biological process
GO:0003382	epithelial cell morphogenesis	IEA	biological process
GO:0002244	hematopoietic progenitor cell differentiation	IEA	biological process

Diseases

Associated diseases	References
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray