• Gene id: 167826

Gene Summary

• Gene Symbol: OLIG3   Gene   UCSC   Ensembl
• Aliases: Bhlhb7, bHLHe20
• Gene name: oligodendrocyte transcription factor 3
• Alternate names: oligodendrocyte transcription factor 3, class B basic helix-loop-helix protein 7, class E basic helix-loop-helix protein 20, oligo3,
• Gene location: 6q23.3 (137494393: 137492198)     Exons: 1     NC_000006.12
• OMIM: 609323

Protein Summary

• Protein general information: Q7RTU3  
  • Name: Oligodendrocyte transcription factor 3 (Oligo3) (Class B basic helix loop helix protein 7) (bHLHb7) (Class E basic helix loop helix protein 20) (bHLHe20)
  • Length: 272  
  • Mass: 29358
• Sequence:

  MNSDSSSVSSRASSPDMDEMYLRDHHHRHHHHQESRLNSVSSTQGDMMQKMPGESLSRAGAKAAGESSKYKIKKQ
  LSEQDLQQLRLKINGRERKRMHDLNLAMDGLREVMPYAHGPSVRKLSKIATLLLARNYILMLTSSLEEMKRLVGE
  IYGGHHSAFHCGTVGHSAGHPAHAANSVHPVHPILGGALSSGNASSPLSAASLPAIGTIRPPHSLLKAPSTPPAL
  QLGSGFQHWAGLPCPCTICQMPPPPHLSALSTANMARLSAESKDLLK

• Structural information:
  • Protein Domains: (83..13-)
    (/note="bHLH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00981"-)
  • Interpro: IPR011598  IPR036638  IPR032659  
  • Prosite: PS50888
  • CDD: cd00083
  • STRING: ENSP00000356708
• Other Databases: GeneCards:  OLIG3  Malacards:  OLIG3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0021520	spinal cord motor neuron cell fate specification	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0046983	protein dimerization activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0021522	spinal cord motor neuron differentiation	IEA	biological process
GO:0021520	spinal cord motor neuron cell fate specification	IEA	biological process
GO:0097476	spinal cord motor neuron migration	IEA	biological process
GO:0010468	regulation of gene expression	IEA	biological process
GO:0003714	transcription corepressor activity	IEA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)