• Gene id: 167153

Gene Summary

• Gene Symbol: TENT2   Gene   UCSC   Ensembl
• Aliases: APD4, GLD2, PAPD4, TUT2
• Gene name: terminal nucleotidyltransferase 2
• Alternate names: poly(A) RNA polymerase GLD2, PAP associated domain containing 4, PAP-associated domain-containing protein 4, TUTase 2, hGLD-2, poly(A) RNA polymerase D4, non-canonical, terminal uridylyltransferase 2,
• Gene location: 5q14.1 (79612416: 79688245)     Exons: 1     NC_000005.10
• OMIM: 614121

Protein Summary

• Protein general information: Q6PIY7  
  • Name: Poly(A) RNA polymerase GLD2 (hGLD 2) (EC 2.7.7.19) (PAP associated domain containing protein 4) (Terminal nucleotidyltransferase 2) (Terminal uridylyltransferase 2) (TUTase 2)
  • Length: 484  
  • Mass: 56028
  • Tissue specificity: Expressed in brain. Within brain, it is expressed in cerebellum, hippocampus and medulla. {ECO
• Sequence:

  MFPNSILGRPPFTPNHQQHNNFFTLSPTVYSHQQLIDAQFNFQNADLSRAVSLQQLTYGNVSPIQTSASPLFRGR
  KRLSDEKNLPLDGKRQRFHSPHQEPTVVNQIVPLSGERRYSMPPLFHTHYVPDIVRCVPPFREIAFLEPREITLP
  EAKDKLSQQILELFETCQQQISDLKKKELCRTQLQREIQLLFPQSRLFLVGSSLNGFGTRSSDGDLCLVVKEEPC
  FFQVNQKTEARHILTLVHKHFCTRLSGYIERPQLIRAKVPIVKFRDKVSCVEFDLNVNNIVGIRNTFLLRTYAYL
  ENRVRPLVLVIKKWASHHQINDASRGTLSSYSLVLMVLHYLQTLPEPILPSLQKIYPESFSPAIQLHLVHQAPCN
  VPPYLSKNESNLGDLLLGFLKYYATEFDWNSQMISVREAKAIPRPDGIEWRNKYICVEEPFDGTNTARAVHEKQK
  FDMIKDQFLKSWHRLKNKRDLNSILPVRAAVLKR

• Structural information:
  • Protein Domains: (386..44-)
    (/note="PAP-associated"-)
  • Interpro: IPR002058  
  • STRING: ENSP00000397563
• Other Databases: GeneCards:  TENT2  Malacards:  TENT2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016779	nucleotidyltransferase activity	IBA	molecular function
GO:0006397	mRNA processing	IBA	biological process
GO:0006378	mRNA polyadenylation	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0004652	polynucleotide adenylyltransferase activity	IBA	molecular function
GO:0043489	RNA stabilization	IDA	biological process
GO:0070566	adenylyltransferase activity	IDA	molecular function
GO:2000626	negative regulation of miRNA catabolic process	IDA	biological process
GO:0034062	5'-3' RNA polymerase activity	IDA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0006397	mRNA processing	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0004652	polynucleotide adenylyltransferase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0021766	hippocampus development	IEA	biological process
GO:0060041	retina development in camera-type eye	IEA	biological process
GO:1990603	dark adaptation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0030182	neuron differentiation	IEA	biological process
GO:0002244	hematopoietic progenitor cell differentiation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0004652	polynucleotide adenylyltransferase activity	IDA	molecular function
GO:0043631	RNA polyadenylation	IDA	biological process
GO:0031380	nuclear RNA-directed RNA polymerase complex	IC	cellular component
GO:0071044	histone mRNA catabolic process	IMP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 21412036
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21412036	Cryptorchidism			23 (4 controls, 19 cases)	Male infertility	GSE25518 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R