• Gene id: 167

Gene Summary

• Gene Symbol: CRISP1   Gene   UCSC   Ensembl
• Aliases: AEGL1, ARP, CRISP-1, HEL-S-57, HSCRISP1D, HSCRISP1G, HUMARP
• Gene name: cysteine rich secretory protein 1
• Alternate names: cysteine-rich secretory protein 1, AEG-like protein, AEG-related protein, acidic epididymal glycoprotein homolog, acidic epididymal glycoprotein-like 1, cysteine-rich secretory protein-1 delta, epididymis secretory protein Li 57,
• Gene location: 6p12.3 (49877095: 49833938)     Exons: 11     NC_000006.12
• Gene summary(Entrez): Fertilization consists of a sequence of specific cell-cell interactions culminating in the fusion of the sperm and egg plasma membranes. Recognition, binding, and fusion occur through the interaction of complementary molecules that are localized to specif
• OMIM: 601193

SNPs

rs11135484

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000005.10   g.96886185A>G
NC_000005.9   g.96221889A>G
NG_027839.2   g.54799T>C
NG_051092.1   g.15247A>G|SEQ=[A/G]|GENE=ERAP1
ERAP2   64167

Protein Summary

• Protein general information: P54107  
  • Name: Cysteine rich secretory protein 1 (CRISP 1) (AEG like protein) (ARP) (Acidic epididymal glycoprotein homolog)
  • Length: 249  
  • Mass: 28,481
• Sequence:

  MEIKHLLFLVAAACLLPMLSMKKKSARDQFNKLVTDLPNVQEEIVNIHNALRRRVVPPASNMLKMSWSEEAAQNA
  RIFSKYCDMTESNPLERRLPNTFCGENMHMTSYPVSWSSVIGVWYSESTSFKHGEWTTTDDDITTDHYTQIVWAT
  SYLIGCAIASCRQQGSPRYLYVCHYCHEGNDPETKNEPYKTGVPCEACPSNCEDKLCTNPCIYYDEYFDCDIQVH
  YLGCNHSTTILFCKATCLCDTEIK

• Structural information:
  • Protein Domains: SCP (45-175)
    ShKT. (211-244)
  • Interpro: IPR001283  IPR018244  IPR014044  IPR035940  IPR013871   IPR034117  IPR003582  IPR002413  
  • Prosite: PS01009 PS01010 PS51670
  • CDD: cd05383
  • STRING: ENSP00000338276
• Other Databases: GeneCards:  CRISP1  Malacards:  CRISP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005246	calcium channel regulator activity	IEA	molecular function
GO:0005615	extracellular space	TAS	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0007339	binding of sperm to zona pellucida	IEA	biological process
GO:0007342	fusion of sperm to egg plasma membrane	TAS	biological process
GO:0060046	regulation of acrosome reaction	IEA	biological process
GO:0005246	calcium channel regulator activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	TAS	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0007339	binding of sperm to zona pellucida	IEA	biological process
GO:0007342	fusion of sperm to egg plasma membrane	TAS	biological process
GO:0060046	regulation of acrosome reaction	IEA	biological process
GO:0005615	extracellular space	TAS	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0007342	fusion of sperm to egg plasma membrane	TAS	biological process

Diseases

Associated diseases	References
Non obstructive azoospermia	MIK: 23987519
Male factor infertility	MIK: 17928628
Azoospermia	MIK: 17928628
Associated with acrosome function	MIK: 29361143
Associated with inhibition of capacitation and acrosome reaction	MIK: 12700197
Azoospermia	MIK: 17928628
Impaired sperm fertilizing ability	MIK: 18571638
Modulates sperm motility	MIK: 26416967
Male infertility	MIK: 26416967
Obstructive azoospermia	MIK: 23987519
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
23987519	Nonobstructive azoospermia, obstructive azoospermia			125 (45 normospermic donors, 80 azoospermic donors)	Male infertility
17928628	Azoospermia				Male infertility	CRISP1 SPINLW1 FAM12B DEFB129 CFTR AQP5 KCNK4 KCNK17 SLC6A20 SLC13A3 DEFB126 and DEFB106A
29361143	Associated with acrosome function				Male infertility
18571638	Impaired sperm fertilizing ability				Male infertility
12700197	Associated with inhibition of capacitation and acrosome reaction				Male infertility
26416967	Modulates sperm motility, Male infertility				Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)