• Gene id: 166979

Gene Summary

• Gene Symbol: CDC20B   Gene   UCSC   Ensembl
• Aliases: G6VTS76519
• Gene name: cell division cycle 20B
• Alternate names: cell division cycle protein 20 homolog B, CDC20 cell division cycle 20 homolog B, CDC20-like protein, cell division cycle 20 homolog B,
• Gene location: 5q11.2 (55173176: 55112970)     Exons: 7     NC_000005.10

Protein Summary

• Protein general information: Q86Y33  
  • Name: Cell division cycle protein 20 homolog B
  • Length: 519  
  • Mass: 57335
• Sequence:

  MEWKLERTAPRRVRTEEEMLWESIMRVLSKDLKQKRSQDSANVLDSVNATYSDFKSNFAKRLSAEVPVASSPITT
  RWQQSQTRALSSDSFGEEQSTTYLPEASGSVLKTPPEKETLTLGSRKEQLKTPSKGISETSNSALHFCKAPHAMD
  RDWKESVASKGQKCLKQLFVTQNVVQQANGKMQLCEQSECVWKGCKDGVRDESFHLKSSGDINDSILQPEVKIHI
  TGLRNDYYLNILDWSFQNLVAIALGSAVYIWNGENHNGIENIDLSLTCNYISSVSWIKEGTCLAVGTSEGEVQLW
  DVVTKKRLRNMLGHLSVVGALSWNHFILSSGSRLGRVYHHDVRVAQHHVGTLRHKQAVCALKWSPDGRLLSSGCS
  DGLLTIWPHDPGASAQGQPLKVITQSTAVKAMDWCPWQSGVLAIGGGMKDGRLHILDINAGKSIQTPSTNSQICS
  LIWLPKTKEIATGQGTPKNDVTVWTCPTVSRSGGFFGHRGRVLHLSLSPDQTRVFSAAADGTASVWNCY

• Structural information:
  • Interpro: IPR033010  IPR015943  IPR001680  IPR019775  IPR017986   IPR036322  
  • Prosite: PS00678 PS50082 PS50294
  • STRING: ENSP00000370781
• Other Databases: GeneCards:  CDC20B  Malacards:  CDC20B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031145	anaphase-promoting complex-dependent catabolic process	IBA	biological process
GO:1905786	positive regulation of anaphase-promoting complex-dependent catabolic process	IBA	biological process
GO:1990757	ubiquitin ligase activator activity	IBA	molecular function
GO:0005680	anaphase-promoting complex	IBA	cellular component
GO:0010997	anaphase-promoting complex binding	IBA	molecular function
GO:0010997	anaphase-promoting complex binding	IEA	molecular function
GO:0097027	ubiquitin-protein transferase activator activity	IEA	molecular function
GO:1904668	positive regulation of ubiquitin protein ligase activity	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)