• Gene id: 166968

Gene Summary

• Gene Symbol: MIER3   Gene   UCSC   Ensembl
• Gene name: MIER family member 3
• Alternate names: mesoderm induction early response protein 3, mesoderm induction early response 1, family member 3, mi-er3,
• Gene location: 5q11.2 (56952129: 56919601)     Exons: 15     NC_000005.10

Protein Summary

• Protein general information: Q7Z3K6  
  • Name: Mesoderm induction early response protein 3 (Mi er3)
  • Length: 550  
  • Mass: 61437
• Sequence:

  MAEASFGSSSPVGSLSSEDHDFDPTAEMLVHDYDDERTLEEEEMMDEGKNFSSEIEDLEKEGTMPLEDLLAFYGY
  EPTIPAVANSSANSSPSELADELPDMTLDKEEIAKDLLSGDDEETQSSADDLTPSVTSHETSDFFPRPLRSNTAC
  DGDKESEVEDVETDSGNSPEDLRKEIMIGLQYQAEIPPYLGEYDGNEKVYENEDQLLWCPDVVLESKVKEYLVET
  SLRTGSEKIMDRISAGTHTRDNEQALYELLKCNHNIKEAIERYCCNGKASQEGMTAWTEEECRSFEHALMLFGKD
  FHLIQKNKVRTRTVAECVAFYYMWKKSERYDYFAQQTRFGKKRYNHHPGVTDYMDRLVDETEALGGTVNASALTS
  NRPEPIPDQQLNILNSFTASDLTALTNSVATVCDPTDVNCLDDSFPPLGNTPRGQVNHVPVVTEELLTLPSNGES
  DCFNLFETGFYHSELNPMNMCSEESERPAKRLKMGIAVPESFMNEVSVNNLGVDFENHTHHITSAKMAVSVADFG
  SLSANETNGFISAHALHQHAALHSE

• Structural information:
  • Protein Domains: (174..27-)
    (/note="ELM2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00512-)
    (277..32-)
    (/note="SANT-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00624"-)
  • Interpro: IPR000949  IPR009057  IPR040138  IPR031156  IPR001005   IPR017884  
  • Prosite: PS51156 PS51293
  • STRING: ENSP00000370596
• Other Databases: GeneCards:  MIER3  Malacards:  MIER3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0042826	histone deacetylase binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0003714	transcription corepressor activity	IBA	molecular function
GO:0001103	RNA polymerase II repressing transcription factor binding	IBA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0005654	nucleoplasm	IBA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016575	histone deacetylation	IEA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0016575	histone deacetylation	IDA	NOT|biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0004407	histone deacetylase activity	IDA	NOT|contributes to

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881