• Gene id: 166012

Gene Summary

• Gene Symbol: CHST13   Gene   UCSC   Ensembl
• Aliases: C4ST3
• Gene name: carbohydrate sulfotransferase 13
• Alternate names: carbohydrate sulfotransferase 13, C4ST-3, carbohydrate (chondroitin 4) sulfotransferase 13, chondroitin 4-O-sulfotransferase 3, chondroitin 4-sulfotransferase 3,
• Gene location: 3q21.3 (126524154: 126543290)     Exons: 3     NC_000003.12
• Gene summary(Entrez): The protein encoded by this gene belongs to the sulfotransferase 2 family. It is localized to the golgi membrane, and catalyzes the transfer of sulfate to the C4 hydroxyl of beta-1,4-linked N-acetylgalactosamine (GalNAc) flanked by glucuronic acid residue
• OMIM: 610124

Protein Summary

• Protein general information: Q8NET6  
  • Name: Carbohydrate sulfotransferase 13 (EC 2.8.2.5) (Chondroitin 4 O sulfotransferase 3) (Chondroitin 4 sulfotransferase 3) (C4ST 3) (C4ST3)
  • Length: 341  
  • Mass: 38920
  • Tissue specificity: Highly expressed in adult liver. Expressed at lower level in kidney, lymph nodes and fetal kidney. {ECO
• Sequence:

  MGRRCCRRRVLAAACLGAALLLLCAAPRSLRPAFGNRALGSSWLGGEKRSPLQKLYDLDQDPRSTLAKVHRQRRD
  LLNSACSRHSRRQRLLQPEDLRHVLVDDAHGLLYCYVPKVACTNWKRVLLALSGQARGDPRAISAQEAHAPGRLP
  SLADFSPAEINRRLRAYLAFLFVREPFERLASAYRNKLARPYSAAFQRRYGARIVQRLRPRALPDARARGHDVRF
  AEFLAYLLDPRTRREEPFNEHWERAHALCHPCRLRYDVVGKFETLAEDAAFVLGLAGASDLSFPGPPRPRGAAAS
  RDLAARLFRDISPFYQRRLFDLYKMDFLLFNYSAPSYLRLL

• Structural information:
  • Interpro: IPR018011  IPR005331  
  • STRING: ENSP00000317404
• Other Databases: GeneCards:  CHST13  Malacards:  CHST13

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008146	sulfotransferase activity	IBA	molecular function
GO:0030166	proteoglycan biosynthetic process	IBA	biological process
GO:0008146	sulfotransferase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016051	carbohydrate biosynthetic process	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0047756	chondroitin 4-sulfotransferase activity	IEA	molecular function
GO:0030206	chondroitin sulfate biosynthetic process	TAS	biological process
GO:0000139	Golgi membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0000139	Golgi membrane	IEA	cellular component
GO:0030206	chondroitin sulfate biosynthetic process	IDA	biological process
GO:0001537	N-acetylgalactosamine 4-O-sulfotransferase activity	IDA	molecular function
GO:0047756	chondroitin 4-sulfotransferase activity	IDA	molecular function
GO:0016021	integral component of membrane	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa00532	Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)