• Gene id: 165829

Gene Summary

• Gene Symbol: GPR156   Gene   UCSC   Ensembl
• Aliases: GABABL, PGR28
• Gene name: G protein-coupled receptor 156
• Alternate names: probable G-protein coupled receptor 156, G protein-coupled receptor PGR28, GABAB-related G-protein coupled receptor,
• Gene location: 3q13.33 (120285221: 120165477)     Exons: 15     NC_000003.12
• Gene summary(Entrez): G protein-coupled receptors (GPCRs) are a large superfamily of cell surface receptors characterized by 7 helical transmembrane domains, together with N-terminal extracellular and C-terminal intracellular domains.[supplied by OMIM, Mar 2008]
• OMIM: 612265

Protein Summary

• Protein general information: Q8NFN8  
  • Name: Probable G protein coupled receptor 156 (G protein coupled receptor PGR28) (GABAB related G protein coupled receptor)
  • Length: 814  
  • Mass: 89097
  • Tissue specificity: Ubiquitous expression both in the CNS and in peripheral tissues. Very high expression in fetal brain and testis relative to expression in other tissues. {ECO
• Sequence:

  MEPEINCSELCDSFPGQELDRRPLHDLCKTTITSSHHSSKTISSLSPVLLGIVWTFLSCGLLLILFFLAFTIHCR
  KNRIVKMSSPNLNIVTLLGSCLTYSSAYLFGIQDVLVGSSMETLIQTRLSMLCIGTSLVFGPILGKSWRLYKVFT
  QRVPDKRVIIKDLQLLGLVAALLMADVILLMTWVLTDPIQCLQILSVSMTVTGKDVSCTSTSTHFCASRYSDVWI
  ALIWGCKGLLLLYGAYLAGLTGHVSSPPVNQSLTIMVGVNLLVLAAGLLFVVTRYLHSWPNLVFGLTSGGIFVCT
  TTINCFIFIPQLKQWKAFEEENQTIRRMAKYFSTPNKSFHTQYGEEENCHPRGEKSSMERLLTEKNAVIESLQEQ
  VNNAKEKIVRLMSAECTYDLPEGAAPPASSPNKDVQAVASVHTLAAAQGPSGHLSDFQNDPGMAARDSQCTSGPS
  SYAQSLEGPGKDSSFSPGKEEKISDSKDFSDHLDSGCSQKPWTEQSLGPERGDQVPMNPSQSLLPERGGSDPQRQ
  RHLENSEEPPERRSRVSSVIREKLQEVLQDLGLGPEASLSTAPSCHQQTWKNSAAFSPQKMPLSKELGFSPYMVR
  RRRAAQRARSHFPGSAPSSVGHRANRTVPGAHSRLHVQNGDSPSLAPQTTDSRVRRPSSRKPSLPSDPQDRPGTL
  EGSKQSQTEPEGARGSKAAFLRQPSGSGRAPSPAAPCLSKASPDLPEQWQLWPPVPSGCASLSSQHSYFDTESSS
  SDEFFCRCHRPYCEICFQSSSDSSDSGTSDTDPEPTGGLASWEKLWARSKPIVNFKDDLKPTLV

• Structural information:
  • Interpro: IPR002455  IPR017978  IPR041946  
  • Prosite: PS50259
  • CDD: cd15292
  • STRING: ENSP00000417261
• Other Databases: GeneCards:  GPR156  Malacards:  GPR156

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004965	G protein-coupled GABA receptor activity	IBA	molecular function
GO:0038039	G protein-coupled receptor heterodimeric complex	IBA	cellular component
GO:0004888	transmembrane signaling receptor activity	IBA	molecular function
GO:0007214	gamma-aminobutyric acid signaling pathway	IBA	biological process
GO:0004965	G protein-coupled GABA receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881