• Gene id: 165721

Gene Summary

• Gene Symbol: DNAJB8   Gene   UCSC   Ensembl
• Aliases: CT156, DJ6
• Gene name: DnaJ heat shock protein family (Hsp40) member B8
• Alternate names: dnaJ homolog subfamily B member 8, DnaJ (Hsp40) homolog, subfamily B, member 8, testicular tissue protein Li 56,
• Gene location: 3q21.3 (38564813: 38488096)     Exons: 17     NC_000015.10
• Gene summary(Entrez): The protein encoded by this gene belongs to the DNAJ/HSP40 family of proteins that regulate chaperone activity. This family member suppresses aggregation and toxicity of polyglutamine proteins, and the C-terminal tail is essential for this activity. It ha
• OMIM: 611337

Protein Summary

• Protein general information: Q8NHS0  
  • Name: DnaJ homolog subfamily B member 8
  • Length: 232  
  • Mass: 25686
• Sequence:

  MANYYEVLGVQASASPEDIKKAYRKLALRWHPDKNPDNKEEAEKKFKLVSEAYEVLSDSKKRSLYDRAGCDSWRA
  GGGASTPYHSPFDTGYTFRNPEDIFREFFGGLDPFSFEFWDSPFNSDRGGRGHGLRGAFSAGFGEFPAFMEAFSS
  FNMLGCSGGSHTTFSSTSFGGSSSGSSGFKSVMSSTEMINGHKVTTKRIVENGQERVEVEEDGQLKSVTVNGKEQ
  LKWMDSK

• Structural information:
  • Protein Domains: (3..6-)
    (/note="J-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00286"-)
  • Interpro: IPR001623  IPR018253  IPR036869  
  • Prosite: PS00636 PS50076
  • CDD: cd06257
  • PDB: 2DMX
  • PDBsum: 2DMX
  • STRING: ENSP00000417418
• Other Databases: GeneCards:  DNAJB8  Malacards:  DNAJB8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061077	chaperone-mediated protein folding	IDA	biological process
GO:0044183	protein folding chaperone	IDA	molecular function
GO:0090084	negative regulation of inclusion body assembly	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0051082	unfolded protein binding	IDA	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0051087	chaperone binding	IPI	molecular function
GO:0051087	chaperone binding	IPI	molecular function
GO:0051087	chaperone binding	IPI	molecular function
GO:0005634	nucleus	HDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq