Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 1656
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary
Gene Symbol DDX6   Gene   UCSC   Ensembl
Aliases HLR2, IDDILF, P54, RCK, Rck/p54
Gene name DEAD-box helicase 6
Alternate names probable ATP-dependent RNA helicase DDX6, ATP-dependent RNA helicase p54, DEAD (Asp-Glu-Ala-Asp) box helicase 6, DEAD (Asp-Glu-Ala-Asp) box polypeptide 6, DEAD box protein 6, DEAD box-6, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 6 (RNA helicase, 54kD), oncoge,
Gene location 11q23.3 (118791695: 118747762)     Exons: 16     NC_000011.10
Gene summary(Entrez) This gene encodes a member of the DEAD box protein family. The protein is an RNA helicase found in P-bodies and stress granules, and functions in translation suppression and mRNA degradation. It is required for microRNA-induced gene silencing. Multiple al
OMIM 600326

Protein Summary
Protein general information P26196  

Name: Probable ATP dependent RNA helicase DDX6 (EC 3.6.4.13) (ATP dependent RNA helicase p54) (DEAD box protein 6) (Oncogene RCK)

Length: 483  Mass: 54417

Tissue specificity: Abundantly expressed in most tissues.

Sequence MSTARTENPVIMGLSSQNGQLRGPVKPTGGPGGGGTQTQQQMNQLKNTNTINNGTQQQAQSMTTTIKPGDDWKKT
LKLPPKDLRIKTSDVTSTKGNEFEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAY
LIPLLERLDLKKDNIQAMVIVPTRELALQVSQICIQVSKHMGGAKVMATTGGTNLRDDIMRLDDTVHVVIATPGR
ILDLIKKGVAKVDHVQMIVLDEADKLLSQDFVQIMEDIILTLPKNRQILLYSATFPLSVQKFMNSHLQKPYEINL
MEELTLKGVTQYYAYVTERQKVHCLNTLFSRLQINQSIIFCNSSQRVELLAKKISQLGYSCFYIHAKMRQEHRNR
VFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLAETYLHRIGRSGRFGHLGLAINLITYDDRFNLKSIE
EQLGTEIKPIPSNIDKSLYVAEYHSEPVEDEKP
Structural information
Protein Domains
 (127..29-)
(/note="Helicase-ATP-binding)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00541-)
(308..46-)
(/note="Helicase-C-terminal)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00542"-)
Interpro:  IPR011545  IPR014001  IPR001650  IPR027417  IPR000629  
IPR014014  
Prosite:   PS00039 PS51192 PS51194 PS51195

PDB:  		 1VEC 2WAX 2WAY 4CRW 4CT4 4CT5 5ANR 6F9S 6S8S
PDBsum:   1VEC 2WAX 2WAY 4CRW 4CT4 4CT5 5ANR 6F9S 6S8S

DIP:  
29195
MINT:  
STRING:   ENSP00000478754
Other Databases GeneCards:  DDX6  Malacards:  DDX6

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0000932 P-body
 IMP cellular component
GO:0019074 viral RNA genome packagin
g
 IMP biological process
GO:0000932 P-body
 IBA cellular component
GO:0003729 mRNA binding
 IBA molecular function
GO:0010494 cytoplasmic stress granul
e
 IBA cellular component
GO:0034063 stress granule assembly
 IBA biological process
GO:0003723 RNA binding
 IBA molecular function
GO:0003724 RNA helicase activity
 IBA molecular function
GO:0033962 cytoplasmic mRNA processi
ng body assembly
 IBA biological process
GO:0000932 P-body
 IDA cellular component
GO:0000932 P-body
 IDA cellular component
GO:0000932 P-body
 IDA cellular component
GO:0010494 cytoplasmic stress granul
e
 IDA cellular component
GO:0000932 P-body
 IDA cellular component
GO:0005737 cytoplasm
 IDA cellular component
GO:0005634 nucleus
 IDA cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0033962 cytoplasmic mRNA processi
ng body assembly
 IMP biological process
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0003676 nucleic acid binding
 IEA molecular function
GO:0005524 ATP binding
 IEA molecular function
GO:0016787 hydrolase activity
 IEA molecular function
GO:0004386 helicase activity
 IEA molecular function
GO:0005634 nucleus
 IEA cellular component
GO:0003723 RNA binding
 IEA molecular function
GO:0000166 nucleotide binding
 IEA molecular function
GO:0005737 cytoplasm
 IEA cellular component
GO:0005524 ATP binding
 IEA molecular function
GO:0003724 RNA helicase activity
 TAS molecular function
GO:0004386 helicase activity
 TAS molecular function
GO:0004386 helicase activity
 TAS molecular function
GO:0003724 RNA helicase activity
 IEA molecular function
GO:0000932 P-body
 IDA cellular component
GO:0000932 P-body
 IDA cellular component
GO:0033962 cytoplasmic mRNA processi
ng body assembly
 IDA biological process
GO:0016442 RISC complex
 IDA cellular component
GO:0043928 exonucleolytic catabolism
of deadenylated mRNA
 TAS biological process
GO:0005829 cytosol
 TAS cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0061830 concave side of sperm hea
d
 IEA cellular component
GO:0048471 perinuclear region of cyt
oplasm
 IEA cellular component
GO:0007283 spermatogenesis
 IEA biological process
GO:0005730 nucleolus
 IEA cellular component
GO:0001520 outer dense fiber
 IEA cellular component
GO:0000792 heterochromatin
 IEA cellular component
GO:0000932 P-body
 IEA cellular component
GO:0097227 sperm annulus
 IEA cellular component
GO:0048515 spermatid differentiation
 IEA biological process
GO:0033391 chromatoid body
 IEA cellular component
GO:0005739 mitochondrion
 IEA cellular component
GO:0045665 negative regulation of ne
uron differentiation
 IEA biological process
GO:0019827 stem cell population main
tenance
 IEA biological process
GO:0005737 cytoplasm
 IEA cellular component
GO:0045296 cadherin binding
 HDA molecular function
GO:0019904 protein domain specific b
inding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0000932 P-body
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0005829 cytosol
 IDA cellular component
GO:0036464 cytoplasmic ribonucleopro
tein granule
 IDA cellular component
GO:0010494 cytoplasmic stress granul
e
 IDA cellular component
GO:0016020 membrane
 HDA cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0003723 RNA binding
 HDA molecular function
GO:0003723 RNA binding
 HDA molecular function

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa03018RNA degradation

Diseases

Expand All | Collapse All
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Cryptorchidism MIK: 21412036
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
21412036 Cryptorchi
dism
23 (4 controls,
19 cases)
 Male infertility GSE25518 analyzed by GEO2R (cutoff 1.5 fold)
 Show abstract
17327269 Teratozoos
permia
19 (6 controls
, 13 cases)
 Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
 Show abstract
17327269 Teratozoos
permia
19 (6 controls
, 13 cases)
 Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
 Show abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm
18
 Male infertility GSE26881
 Show abstract