• Gene id: 165324

Gene Summary

• Gene Symbol: UBXN2A   Gene   UCSC   Ensembl
• Aliases: UBXD4
• Gene name: UBX domain protein 2A
• Alternate names: UBX domain-containing protein 2A, UBX domain containing 4, UBX domain-containing protein 4,
• Gene location: 2p23.3 (91361968: 91213814)     Exons: 16     NC_000009.12

Protein Summary

• Protein general information: P68543  
  • Name: UBX domain containing protein 2A (UBX domain containing protein 4)
  • Length: 259  
  • Mass: 29278
• Sequence:

  MKDVDNLKSIKEEWVCETGSDNQPLGNNQQSNCEYFVDSLFEEAQKVSSKCVSPAEQKKQVDVNIKLWKNGFTVN
  DDFRSYSDGASQQFLNSIKKGELPSELQGIFDKEEVDVKVEDKKNEICLSTKPVFQPFSGQGHRLGSATPKIVSK
  AKNIEVENKNNLSAVPLNNLEPITNIQIWLANGKRIVQKFNITHRVSHIKDFIEKYQGSQRSPPFSLATALPVLR
  LLDETLTLEEADLQNAVIIQRLQKTASFRELSEH

• Structural information:
  • Protein Domains: (60..12-)
    (/note="SEP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00732-)
    (169..24-)
    (/note="UBX-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00215"-)
  • Interpro: IPR036241  IPR012989  IPR029071  IPR001012  
  • Prosite: PS51399 PS50033
  • STRING: ENSP00000312107
• Other Databases: GeneCards:  UBXN2A  Malacards:  UBXN2A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061025	membrane fusion	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0043130	ubiquitin binding	IBA	molecular function
GO:0031468	nuclear envelope reassembly	IBA	biological process
GO:0007030	Golgi organization	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0000045	autophagosome assembly	IBA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005801	cis-Golgi network	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0031396	regulation of protein ubiquitination	IEA	biological process
GO:0033130	acetylcholine receptor binding	IEA	molecular function
GO:0042176	regulation of protein catabolic process	IEA	biological process
GO:1990830	cellular response to leukemia inhibitory factor	IEA	biological process
GO:0010468	regulation of gene expression	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq