• Gene id: 1649

Gene Summary

• Gene Symbol: DDIT3   Gene   UCSC   Ensembl
• Aliases: AltDDIT3, C/EBPzeta, CEBPZ, CHOP, CHOP-10, CHOP10, GADD153
• Gene name: DNA damage inducible transcript 3
• Alternate names: DNA damage-inducible transcript 3 protein, C/EBP zeta, CCAAT/enhancer-binding protein homologous protein, alternative DDIT3 protein, c/EBP-homologous protein 10, growth arrest and DNA damage-inducible protein GADD153,
• Gene location: 12q13.3 (57520516: 57516587)     Exons: 4     NC_000012.12
• Gene summary(Entrez): This gene encodes a member of the CCAAT/enhancer-binding protein (C/EBP) family of transcription factors. The protein functions as a dominant-negative inhibitor by forming heterodimers with other C/EBP members, such as C/EBP and LAP (liver activator prote
• OMIM: 126337

Protein Summary

• Protein general information: P35638  
  • Name: DNA damage inducible transcript 3 protein (DDIT 3) (C/EBP zeta) (C/EBP homologous protein) (CHOP) (C/EBP homologous protein 10) (CHOP 10) (CCAAT/enhancer binding protein homologous protein) (Growth arrest and DNA damage inducible protein GADD153)
  • Length: 169  
  • Mass: 19175
• Sequence:

  MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTS
  TSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENERLKQEIERLTR
  EVEATRRALIDRMVNLHQA

• Structural information:
  • Protein Domains: (99..16-)
    (/note="bZIP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00978"-)
  • Interpro: IPR004827  IPR016670  
  • Prosite: PS50217
  • DIP: 41589
  • STRING: ENSP00000448665
• Other Databases: GeneCards:  DDIT3  Malacards:  DDIT3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003713	transcription coactivator activity	ISS	molecular function
GO:0140416	DNA-binding transcription factor inhibitor activity	ISS	molecular function
GO:0051091	positive regulation of DNA-binding transcription factor activity	ISS	biological process
GO:0003700	DNA-binding transcription factor activity	IC	molecular function
GO:0000976	transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0000976	transcription regulatory region sequence-specific DNA binding	IC	molecular function
GO:0043522	leucine zipper domain binding	IDA	molecular function
GO:0043522	leucine zipper domain binding	IDA	molecular function
GO:1990440	positive regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress	IDA	biological process
GO:1990440	positive regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress	IDA	biological process
GO:0003700	DNA-binding transcription factor activity	IGI	molecular function
GO:0000976	transcription regulatory region sequence-specific DNA binding	ISS	molecular function
GO:0032993	protein-DNA complex	IDA	cellular component
GO:0042803	protein homodimerization activity	ISS	NOT|molecular function
GO:0036499	PERK-mediated unfolded protein response	TAS	biological process
GO:0036499	PERK-mediated unfolded protein response	TAS	biological process
GO:0036500	ATF6-mediated unfolded protein response	TAS	biological process
GO:0032792	negative regulation of CREB transcription factor activity	IDA	biological process
GO:0043525	positive regulation of neuron apoptotic process	IC	biological process
GO:1903026	negative regulation of RNA polymerase II regulatory region sequence-specific DNA binding	IDA	biological process
GO:1990617	CHOP-ATF4 complex	IDA	cellular component
GO:1990622	CHOP-ATF3 complex	IDA	cellular component
GO:0008140	cAMP response element binding protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0070059	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	TAS	biological process
GO:0070059	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	TAS	biological process
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:1902237	positive regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway	IC	biological process
GO:1990440	positive regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress	IGI	biological process
GO:1990440	positive regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress	IMP	biological process
GO:1990440	positive regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress	ISS	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:1990617	CHOP-ATF4 complex	IPI	cellular component
GO:0005667	transcription regulator complex	NAS	cellular component
GO:0032792	negative regulation of CREB transcription factor activity	IGI	biological process
GO:0036488	CHOP-C/EBP complex	ISS	cellular component
GO:0036488	CHOP-C/EBP complex	TAS	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IGI	biological process
GO:0051898	negative regulation of protein kinase B signaling	IMP	biological process
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	molecular function
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0007050	cell cycle arrest	IDA	biological process
GO:1990622	CHOP-ATF3 complex	IBA	cellular component
GO:1990617	CHOP-ATF4 complex	IBA	cellular component
GO:1990440	positive regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress	IBA	biological process
GO:0046982	protein heterodimerization activity	IBA	molecular function
GO:0036488	CHOP-C/EBP complex	IBA	cellular component
GO:0008134	transcription factor binding	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:2001244	positive regulation of intrinsic apoptotic signaling pathway	IBA	biological process
GO:0070059	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IBA	biological process
GO:0032792	negative regulation of CREB transcription factor activity	IBA	biological process
GO:0006983	ER overload response	IBA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IBA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0070059	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IDA	biological process
GO:0070059	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0006986	response to unfolded protein	IDA	biological process
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0034976	response to endoplasmic reticulum stress	IDA	biological process
GO:0034976	response to endoplasmic reticulum stress	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0003677	DNA binding	IDA	molecular function
GO:0070059	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IMP	biological process
GO:0032757	positive regulation of interleukin-8 production	IMP	biological process
GO:0003700	DNA-binding transcription factor activity	ISS	molecular function
GO:0030968	endoplasmic reticulum unfolded protein response	ISS	biological process
GO:2001244	positive regulation of intrinsic apoptotic signaling pathway	IMP	biological process
GO:0010506	regulation of autophagy	ISS	biological process
GO:2001244	positive regulation of intrinsic apoptotic signaling pathway	ISS	biological process
GO:0006355	regulation of transcription, DNA-templated	IMP	biological process
GO:0006355	regulation of transcription, DNA-templated	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008140	cAMP response element binding protein binding	ISS	molecular function
GO:0043525	positive regulation of neuron apoptotic process	ISS	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006986	response to unfolded protein	IEA	biological process
GO:0007050	cell cycle arrest	IEA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0003700	DNA-binding transcription factor activity	NAS	molecular function
GO:0006974	cellular response to DNA damage stimulus	TAS	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IDA	biological process
GO:0045454	cell redox homeostasis	IDA	biological process
GO:0003677	DNA binding	IDA	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0036499	PERK-mediated unfolded protein response	TAS	biological process
GO:0036500	ATF6-mediated unfolded protein response	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000016	negative regulation of determination of dorsal identity	IEA	biological process
GO:1990442	intrinsic apoptotic signaling pathway in response to nitrosative stress	IEA	biological process
GO:0090575	RNA polymerase II transcription regulator complex	IEA	cellular component
GO:0070059	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0045662	negative regulation of myoblast differentiation	IEA	biological process
GO:0045599	negative regulation of fat cell differentiation	IEA	biological process
GO:0042594	response to starvation	IEA	biological process
GO:0030968	endoplasmic reticulum unfolded protein response	IEA	biological process
GO:0006983	ER overload response	IEA	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0001955	blood vessel maturation	IEA	biological process
GO:1990440	positive regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress	IEA	biological process
GO:1901216	positive regulation of neuron death	IEA	biological process
GO:0120163	negative regulation of cold-induced thermogenesis	IEA	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0072655	establishment of protein localization to mitochondrion	IEA	biological process
GO:0051209	release of sequestered calcium ion into cytosol	IEA	biological process
GO:0051091	positive regulation of DNA-binding transcription factor activity	IEA	biological process
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0044324	regulation of transcription involved in anterior/posterior axis specification	IEA	biological process
GO:0043525	positive regulation of neuron apoptotic process	IEA	biological process
GO:0043392	negative regulation of DNA binding	IEA	biological process
GO:0036488	CHOP-C/EBP complex	IEA	cellular component
GO:0034976	response to endoplasmic reticulum stress	IEA	biological process
GO:0008134	transcription factor binding	IEA	molecular function
GO:0006915	apoptotic process	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005770	late endosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003713	transcription coactivator activity	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0008134	transcription factor binding	IPI	molecular function
GO:0008134	transcription factor binding	IPI	molecular function
GO:0043433	negative regulation of DNA-binding transcription factor activity	IDA	biological process
GO:2000016	negative regulation of determination of dorsal identity	IDA	biological process
GO:0043618	regulation of transcription from RNA polymerase II promoter in response to stress	TAS	biological process
GO:0034976	response to endoplasmic reticulum stress	IDA	biological process
GO:0044324	regulation of transcription involved in anterior/posterior axis specification	ISS	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	ISS	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0120163	negative regulation of cold-induced thermogenesis	ISS	biological process
GO:0043433	negative regulation of DNA-binding transcription factor activity	IMP	biological process
GO:0051091	positive regulation of DNA-binding transcription factor activity	IMP	biological process
GO:0051091	positive regulation of DNA-binding transcription factor activity	IMP	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05010	Alzheimer disease
hsa04010	MAPK signaling pathway
hsa05012	Parkinson disease
hsa04141	Protein processing in endoplasmic reticulum
hsa05202	Transcriptional misregulation in cancer
hsa04932	Non-alcoholic fatty liver disease
hsa04210	Apoptosis

Diseases

Associated diseases	References
Myxoid liposarcoma	KEGG:H00049
Myxoid liposarcoma	KEGG:H00049
Myxoid liposarcoma	PMID:1283316
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)