• Gene id: 164781

Gene Summary

• Gene Symbol: DAW1   Gene   UCSC   Ensembl
• Aliases: ODA16, WDR69
• Gene name: dynein assembly factor with WD repeats 1
• Alternate names: dynein assembly factor with WDR repeat domains 1, WD repeat domain 69, WD repeat-containing protein 69, outer row dynein assembly 16 homolog, outer row dynein assembly protein 16 homolog, testis tissue sperm-binding protein Li 93mP,
• Gene location: 2q36.3 (119268758: 119399687)     Exons: 7     NC_000005.10

Protein Summary

• Protein general information: Q8N136  
  • Name: Dynein assembly factor with WDR repeat domains 1 (Outer row dynein assembly protein 16 homolog) (WD repeat containing protein 69)
  • Length: 415  
  • Mass: 45777
• Sequence:

  MKLKSLLLRYYPPGIMLEYEKHGELKTKSIDLLDLGPSTDVSALVEEIQKAEPLLTASRTEQVKLLIQRLQEKLG
  QNSNHTFYLFKVLKAHILPLTNVALNKSGSCFITGSYDRTCKLWDTASGEELNTLEGHRNVVYAIAFNNPYGDKI
  ATGSFDKTCKLWSVETGKCYHTFRGHTAEIVCLSFNPQSTLVATGSMDTTAKLWDIQNGEEVYTLRGHSAEIISL
  SFNTSGDRIITGSFDHTVVVWDADTGRKVNILIGHCAEISSASFNWDCSLILTGSMDKTCKLWDATNGKCVATLT
  GHDDEILDSCFDYTGKLIATASADGTARIFSAATRKCIAKLEGHEGEISKISFNPQGNHLLTGSSDKTARIWDAQ
  TGQCLQVLEGHTDEIFSCAFNYKGNIVITGSKDNTCRIWR

• Structural information:
  • Interpro: IPR020472  IPR015943  IPR001680  IPR019775  IPR017986   IPR036322  
  • Prosite: PS00678 PS50082 PS50294
  • PDB: 5NNZ
  • PDBsum: 5NNZ
  • STRING: ENSP00000311899
• Other Databases: GeneCards:  DAW1  Malacards:  DAW1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042995	cell projection	IEA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0008150	biological_process	ND	biological process
GO:0005575	cellular_component	ND	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray