• Gene id: 1647

Gene Summary

• Gene Symbol: GADD45A   Gene   UCSC   Ensembl
• Aliases: DDIT1, GADD45
• Gene name: growth arrest and DNA damage inducible alpha
• Alternate names: growth arrest and DNA damage-inducible protein GADD45 alpha, DDIT-1, DNA damage-inducible transcript 1 protein, DNA damage-inducible transcript-1, growth arrest and DNA-damage-inducible 45 alpha,
• Gene location: 1p31.3 (67685200: 67688333)     Exons: 7     NC_000001.11
• Gene summary(Entrez): This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activatio
• OMIM: 126335

Protein Summary

• Protein general information: P24522  
  • Name: Growth arrest and DNA damage inducible protein GADD45 alpha (DNA damage inducible transcript 1 protein) (DDIT 1)
  • Length: 165  
  • Mass: 18336
• Sequence:

  MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHF
  TLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRES
  RYMDQWVPVINLPER

• Structural information:
  • Interpro: IPR024824  IPR029064  IPR004038  
  • PDB: 2KG4
  • PDBsum: 2KG4
  • DIP: 24217
  • STRING: ENSP00000360025
• Other Databases: GeneCards:  GADD45A  Malacards:  GADD45A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071901	negative regulation of protein serine/threonine kinase activity	IMP	biological process
GO:0043537	negative regulation of blood vessel endothelial cell migration	IMP	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IMP	biological process
GO:0071850	mitotic cell cycle arrest	IDA	biological process
GO:0033140	negative regulation of peptidyl-serine phosphorylation of STAT protein	IMP	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0000185	activation of MAPKKK activity	IBA	biological process
GO:0051726	regulation of cell cycle	IBA	biological process
GO:0051726	regulation of cell cycle	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0007050	cell cycle arrest	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0000079	regulation of cyclin-dependent protein serine/threonine kinase activity	TAS	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0006281	DNA repair	TAS	biological process
GO:0007050	cell cycle arrest	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006977	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	TAS	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043537	negative regulation of blood vessel endothelial cell migration	IEA	biological process
GO:0033140	negative regulation of peptidyl-serine phosphorylation of STAT protein	IEA	biological process
GO:0007098	centrosome cycle	IEA	biological process
GO:0006469	negative regulation of protein kinase activity	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:1990841	promoter-specific chromatin binding	IEA	molecular function
GO:0051726	regulation of cell cycle	IEA	biological process
GO:0016525	negative regulation of angiogenesis	IEA	biological process
GO:0042770	signal transduction in response to DNA damage	IMP	biological process
GO:0071479	cellular response to ionizing radiation	IMP	biological process
GO:2000379	positive regulation of reactive oxygen species metabolic process	IMP	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0019900	kinase binding	IPI	molecular function
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0047485	protein N-terminus binding	IDA	molecular function
GO:1900745	positive regulation of p38MAPK cascade	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0000185	activation of MAPKKK activity	IDA	biological process
GO:0046330	positive regulation of JNK cascade	IDA	biological process
GO:0043065	positive regulation of apoptotic process	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0071260	cellular response to mechanical stimulus	IEP	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04010	MAPK signaling pathway
hsa05169	Epstein-Barr virus infection
hsa05202	Transcriptional misregulation in cancer
hsa05225	Hepatocellular carcinoma
hsa05226	Gastric cancer
hsa04218	Cellular senescence
hsa05224	Breast cancer
hsa04110	Cell cycle
hsa04210	Apoptosis
hsa04068	FoxO signaling pathway
hsa04064	NF-kappa B signaling pathway
hsa05222	Small cell lung cancer
hsa05210	Colorectal cancer
hsa05220	Chronic myeloid leukemia
hsa05217	Basal cell carcinoma
hsa05214	Glioma
hsa05212	Pancreatic cancer
hsa05218	Melanoma
hsa04115	p53 signaling pathway
hsa05223	Non-small cell lung cancer
hsa05213	Endometrial cancer
hsa05216	Thyroid cancer

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R