• Gene id: 164633

Gene Summary

• Gene Symbol: CABP7   Gene   UCSC   Ensembl
• Aliases: CALN2
• Gene name: calcium binding protein 7
• Alternate names: calcium-binding protein 7, calneuron 2, calneuron II,
• Gene location: 22q12.2 (29720002: 29731832)     Exons: 5     NC_000022.11
• OMIM: 616692

Protein Summary

• Protein general information: Q86V35  
  • Name: Calcium binding protein 7 (CaBP7) (Calneuron II) (Calneuron 2)
  • Length: 215  
  • Mass: 24453
• Sequence:

  MPFHPVTAALMYRGIYTVPNLLSEQRPVDIPEDELEEIREAFKVFDRDGNGFISKQELGTAMRSLGYMPNEVELE
  VIIQRLDMDGDGQVDFEEFVTLLGPKLSTSGIPEKFHGTDFDTVFWKCDMQKLTVDELKRLLYDTFCEHLSMKDI
  ENIIMTEEESHLGTAEECPVDVETCSNQQIRQTCVRKSLICAFAIAFIISVMLIAANQVLRSGMK

• Structural information:
  • Protein Domains: (33..6-)
    (/note="EF-hand-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (69..10-)
    (/note="EF-hand-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448"-)
  • Interpro: IPR011992  IPR018247  IPR002048  IPR001751  
  • Prosite: PS00018 PS50222
  • CDD: cd00051
  • PDB: 2LV7
  • PDBsum: 2LV7
  • STRING: ENSP00000216144
• Other Databases: GeneCards:  CABP7  Malacards:  CABP7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005509	calcium ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0032588	trans-Golgi network membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0032588	trans-Golgi network membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq