• Gene id: 164237

Gene Summary

• Gene Symbol: WFDC13   Gene   UCSC   Ensembl
• Aliases: C20orf138, WAP13, dJ601O1.3
• Gene name: WAP four-disulfide core domain 13
• Alternate names: WAP four-disulfide core domain protein 13, protease inhibitor WAP13, protein WFDC13,
• Gene location: 20q13.12 (45702037: 45708816)     Exons: 4     NC_000020.11
• Gene summary(Entrez): This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. Most WFD

Protein Summary

• Protein general information: Q8IUB5  
  • Name: WAP four disulfide core domain protein 13
  • Length: 93  
  • Mass: 10386
• Sequence:

  MKPVLPLQFLVVFCLALQLVPGSPKQRVLKYILEPPPCISAPENCTHLCTMQEDCEKGFQCCSSFCGIVCSSETF
  QKRNRIKHKGSEVIMPAN

• Structural information:
  • Protein Domains: (24..7-)
    (/note="WA-)
    (-)
  • Interpro: IPR029720  
  • STRING: ENSP00000302938
• Other Databases: GeneCards:  WFDC13  Malacards:  WFDC13

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0019731	antibacterial humoral response	IBA	biological process
GO:0045087	innate immune response	IBA	biological process
GO:0004867	serine-type endopeptidase inhibitor activity	IBA	molecular function
GO:0010466	negative regulation of peptidase activity	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0030414	peptidase inhibitor activity	IEA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)