• Gene id: 164153

Gene Summary

• Gene Symbol: UBL4B   Gene   UCSC   Ensembl
• Gene name: ubiquitin like 4B
• Alternate names: ubiquitin-like protein 4B,
• Gene location: 1p13.3 (110112442: 110113946)     Exons: 24     NC_000001.11
• OMIM: 611127

Protein Summary

• Protein general information: Q8N7F7  
  • Name: Ubiquitin like protein 4B
  • Length: 174  
  • Mass: 19909
• Sequence:

  MFLTVKLLLGQRCSLKVSGQESVATLKRLVSRRLKVPEEQQHLLFRGQLLEDDKHLSDYCIGPNASINVIMQPLE
  KMALKEAHQPQTQPLWHQLGLVLAKHFEPQDAKAVLQLLRQEHEERLQKISLEHLEQLAQYLLAEEPHVEPAGER
  ELEAKARPQSSCDMEEKEEAAADQ

• Structural information:
  • Protein Domains: (1..7-)
    (/note="Ubiquitin-like-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00214"-)
  • Interpro: IPR000626  IPR029071  IPR041421  
  • Prosite: PS50053
  • STRING: ENSP00000334044
• Other Databases: GeneCards:  UBL4B  Malacards:  UBL4B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1903955	positive regulation of protein targeting to mitochondrion	HMP	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)