• Gene id: 164091

Gene Summary

• Gene Symbol: PAQR7   Gene   UCSC   Ensembl
• Aliases: MPRA, PGLP, mSR
• Gene name: progestin and adipoQ receptor family member 7
• Alternate names: membrane progestin receptor alpha, 2310021M12Rik, mPR alpha, membrane progesterone P4 receptor alpha, membrane progesterone receptor alpha, progesterone and adipoQ receptor family member 7, progestin and adipoQ receptor family member VII,
• Gene location: 1p36.11 (25876706: 25861483)     Exons: 5     NC_000001.11
• OMIM: 612504

Protein Summary

• Protein general information: Q86WK9  
  • Name: Membrane progestin receptor alpha (mPR alpha) (Membrane progesterone P4 receptor alpha) (Membrane progesterone receptor alpha) (Progesterone and adipoQ receptor family member 7) (Progestin and adipoQ receptor family member 7) (Progestin and adipoQ recepto
  • Length: 346  
  • Mass: 39719
  • Tissue specificity: Expressed in a wide range of tissues including ovary, testis, placenta, uterus and bladder. {ECO
• Sequence:

  MAMAQKLSHLLPSLRQVIQEPQLSLQPEPVFTVDRAEVPPLFWKPYIYAGYRPLHQTWRFYFRTLFQQHNEAVNV
  WTHLLAALVLLLRLALFVETVDFWGDPHALPLFIIVLASFTYLSFSALAHLLQAKSEFWHYSFFFLDYVGVAVYQ
  FGSALAHFYYAIEPAWHAQVQAVFLPMAAFLAWLSCIGSCYNKYIQKPGLLGRTCQEVPSVLAYALDISPVVHRI
  FVSSDPTTDDPALLYHKCQVVFFLLAAAFFSTFMPERWFPGSCHVFGQGHQLFHIFLVLCTLAQLEAVALDYEAR
  RPIYEPLHTHWPHNFSGLFLLTVGSSILTAFLLSQLVQRKLDQKTK

• Structural information:
  • Interpro: IPR004254  
  • STRING: ENSP00000363414
• Other Databases: GeneCards:  PAQR7  Malacards:  PAQR7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0048545	response to steroid hormone	IBA	biological process
GO:0038023	signaling receptor activity	IBA	molecular function
GO:0003707	steroid hormone receptor activity	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0005496	steroid binding	IBA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0048477	oogenesis	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0008289	lipid binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005496	steroid binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0043401	steroid hormone mediated signaling pathway	IEA	biological process

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray