• Gene id: 163732

Gene Summary

• Gene Symbol: CITED4   Gene   UCSC   Ensembl
• Gene name: Cbp/p300 interacting transactivator with Glu/Asp rich carboxy-terminal domain 4
• Alternate names: cbp/p300-interacting transactivator 4, MRG-2, MSG1-related protein 2, transcriptional co-activator 4,
• Gene location: 1p35-p34 (40862362: 40861053)     Exons: 1     NC_000001.11
• Gene summary(Entrez): The protein encoded by this intronless gene belongs to the CITED family of transcriptional coactivators that bind to several proteins, including CREB-binding protein (CBP) and p300, via a conserved 32 aa C-terminal motif, and regulate gene transcription.
• OMIM: 606815

Protein Summary

• Protein general information: Q96RK1  
  • Name: Cbp/p300 interacting transactivator 4 (MSG1 related protein 2) (MRG 2)
  • Length: 184  
  • Mass: 18569
  • Tissue specificity: Expressed in most tissues examined with highest levels of expression in heart, liver, skeletal muscle and pancreas. Also expressed in bladder cell line ECV-304 and in various breast cancer cell lines. Also detected in both in situ and
• Sequence:

  MADHLMLAEGYRLVQRPPSAAAAHGPHALRTLPPYAGPGLDSGLRPRGAPLGPPPPRQPGALAYGAFGPPSSFQP
  FPAVPPPAAGIAHLQPVATPYPGRAAAPPNAPGGPPGPQPAPSAAAPPPPAHALGGMDAELIDEEALTSLELELG
  LHRVRELPELFLGQSEFDCFSDLGSAPPAGSVSC

• Structural information:
  • Interpro: IPR007576  
  • STRING: ENSP00000361721
• Other Databases: GeneCards:  CITED4  Malacards:  CITED4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0003713	transcription coactivator activity	IBA	molecular function
GO:0043627	response to estrogen	ISS	biological process
GO:0003713	transcription coactivator activity	ISS	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0043627	response to estrogen	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003713	transcription coactivator activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881