• Gene id: 163688

Gene Summary

• Gene Symbol: CALML6   Gene   UCSC   Ensembl
• Aliases: CAGLP
• Gene name: calmodulin like 6
• Alternate names: calmodulin-like protein 6, EF-hand protein, calglandulin-like protein,
• Gene location: 1p36.33 (1913750: 1917295)     Exons: 6     NC_000001.11
• OMIM: 610171

Protein Summary

• Protein general information: Q8TD86  
  • Name: Calmodulin like protein 6 (Calglandulin like protein)
  • Length: 181  
  • Mass: 20690
  • Tissue specificity: Expressed in prostate, thymus, heart, skeleton muscle, bone marrow and ovary. {ECO
• Sequence:

  MGLQQEISLQPWCHHPAESCQTTTDMTERLSAEQIKEYKGVFEMFDEEGNGEVKTGELEWLMSLLGINPTKSELA
  SMAKDVDRDNKGFFNCDGFLALMGVYHEKAQNQESELRAAFRVFDKEGKGYIDWNTLKYVLMNAGEPLNEVEAEQ
  MMKEADKDGDRTIDYEEFVAMMTGESFKLIQ

• Structural information:
  • Protein Domains: (33..6-)
    (/note="EF-hand-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (69..10-)
    (/note="EF-hand-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (107..14-)
    (/note="EF-hand-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00-)
  • Interpro: IPR011992  IPR018247  IPR002048  
  • Prosite: PS00018 PS50222
  • CDD: cd00051
  • STRING: ENSP00000304643
• Other Databases: GeneCards:  CALML6  Malacards:  CALML6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005509	calcium ion binding	IBA	molecular function
GO:0030234	enzyme regulator activity	IBA	molecular function
GO:0000226	microtubule cytoskeleton organization	IBA	biological process
GO:0019722	calcium-mediated signaling	IBA	biological process
GO:0005509	calcium ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0050790	regulation of catalytic activity	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05010	Alzheimer disease
hsa05012	Parkinson disease
hsa04014	Ras signaling pathway
hsa04015	Rap1 signaling pathway
hsa04024	cAMP signaling pathway
hsa05163	Human cytomegalovirus infection
hsa04020	Calcium signaling pathway
hsa05034	Alcoholism
hsa05170	Human immunodeficiency virus 1 infection
hsa04022	cGMP-PKG signaling pathway
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa04261	Adrenergic signaling in cardiomyocytes
hsa05152	Tuberculosis
hsa04740	Olfactory transduction
hsa04921	Oxytocin signaling pathway
hsa04371	Apelin signaling pathway
hsa04910	Insulin signaling pathway
hsa04218	Cellular senescence
hsa04728	Dopaminergic synapse
hsa04270	Vascular smooth muscle contraction
hsa05418	Fluid shear stress and atherosclerosis
hsa04114	Oocyte meiosis
hsa04722	Neurotrophin signaling pathway
hsa04070	Phosphatidylinositol signaling system
hsa04915	Estrogen signaling pathway
hsa04922	Glucagon signaling pathway
hsa04916	Melanogenesis
hsa04713	Circadian entrainment
hsa04625	C-type lectin receptor signaling pathway
hsa04925	Aldosterone synthesis and secretion
hsa04750	Inflammatory mediator regulation of TRP channels
hsa04970	Salivary secretion
hsa04912	GnRH signaling pathway
hsa04971	Gastric acid secretion
hsa04720	Long-term potentiation
hsa05031	Amphetamine addiction
hsa04924	Renin secretion
hsa05214	Glioma
hsa05133	Pertussis
hsa04744	Phototransduction

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray