• Gene id: 1635

Gene Summary

• Gene Symbol: DCTD   Gene   UCSC   Ensembl
• Gene name: dCMP deaminase
• Alternate names: deoxycytidylate deaminase,
• Gene location: 4q35.1 (182917476: 182890090)     Exons: 10     NC_000004.12
• Gene summary(Entrez): The protein encoded by this gene catalyzes the deamination of dCMP to dUMP, the nucleotide substrate for thymidylate synthase. The encoded protein is allosterically activated by dCTP and inhibited by dTTP, and is found as a homohexamer. This protein uses
• OMIM: 138570

Protein Summary

• Protein general information: P32321  
  • Name: Deoxycytidylate deaminase (EC 3.5.4.12) (dCMP deaminase)
  • Length: 178  
  • Mass: 20016
• Sequence:

  MSEVSCKKRDDYLEWPEYFMAVAFLSAQRSKDPNSQVGACIVNSENKIVGIGYNGMPNGCSDDVLPWRRTAENKL
  DTKYPYVCHAELNAIMNKNSTDVKGCSMYVALFPCNECAKLIIQAGIKEVIFMSDKYHDSDEATAARLLFNMAGV
  TFRKFIPKCSKIVIDFDSINSRPSQKLQ

• Structural information:
  • Protein Domains: (14..14-)
    (/note="CMP/dCMP-type-deaminase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01083"-)
  • Interpro: IPR016192  IPR002125  IPR016193  IPR016473  IPR015517   IPR035105  
  • Prosite: PS00903 PS51747
  • CDD: cd01286
  • PDB: 2W4L
  • PDBsum: 2W4L
  • STRING: ENSP00000349576
• Other Databases: GeneCards:  DCTD  Malacards:  DCTD

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0006226	dUMP biosynthetic process	IBA	biological process
GO:0006231	dTMP biosynthetic process	IBA	biological process
GO:0004132	dCMP deaminase activity	IBA	molecular function
GO:0004132	dCMP deaminase activity	IEA	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0006220	pyrimidine nucleotide metabolic process	IEA	biological process
GO:0009165	nucleotide biosynthetic process	IEA	biological process
GO:0008152	metabolic process	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0004132	dCMP deaminase activity	TAS	molecular function
GO:0006220	pyrimidine nucleotide metabolic process	TAS	biological process
GO:0004132	dCMP deaminase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0015949	nucleobase-containing small molecule interconversion	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00240	Pyrimidine metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881