• Gene id: 1634

Gene Summary

• Gene Symbol: DCN   Gene   UCSC   Ensembl
• Aliases: CSCD, DSPG2, PG40, PGII, PGS2, SLRR1B
• Gene name: decorin
• Alternate names: decorin, bone proteoglycan II, dermatan sulphate proteoglycans II, proteoglycan core protein, small leucine-rich protein 1B,
• Gene location: 12q21.33 (91183123: 91143276)     Exons: 12     NC_000012.12
• Gene summary(Entrez): This gene encodes a member of the small leucine-rich proteoglycan family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature prot
• OMIM: 125255

Protein Summary

• Protein general information: P07585  
  • Name: Decorin (Bone proteoglycan II) (PG S2) (PG40)
  • Length: 359  
  • Mass: 39,747
  • Tissue specificity: Testis-specific. Expressed in various cancer cell lines, probably due to demethylation of its promoter. {ECO
• Sequence:

  MKATIILLLLAQVSWAGPFQQRGLFDFMLEDEASGIGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKV
  PKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQLKELPEKMPK
  TLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITSIPQGLPPSLTE
  LHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLH
  NNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYK

• Structural information:
  • Interpro: IPR028549  IPR001611  IPR003591  IPR032675  IPR000372   IPR016352  
  • Prosite: PS51450
  • STRING: ENSP00000052754
• Other Databases: GeneCards:  DCN  Malacards:  DCN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001822	kidney development	IEA	biological process
GO:0001890	placenta development	IEA	biological process
GO:0004860	protein kinase inhibitor activity	IBA	molecular function
GO:0005518	collagen binding	IEA	molecular function
GO:0005539	glycosaminoglycan binding	IEA	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005589	collagen type VI trimer	IEA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0006469	negative regulation of protein kinase activity	IBA	biological process
GO:0007519	skeletal muscle tissue development	IEA	biological process
GO:0007568	aging	IEA	biological process
GO:0009612	response to mechanical stimulus	IEA	biological process
GO:0009887	animal organ morphogenesis	TAS	biological process
GO:0010508	positive regulation of autophagy	IDA	biological process
GO:0010596	negative regulation of endothelial cell migration	IDA	biological process
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IDA	biological process
GO:0016239	positive regulation of macroautophagy	IDA	biological process
GO:0016239	positive regulation of macroautophagy	IGI	biological process
GO:0016525	negative regulation of angiogenesis	IDA	biological process
GO:0019221	cytokine-mediated signaling pathway	IBA	biological process
GO:0019800	peptide cross-linking via chondroitin 4-sulfate glycosaminoglycan	IEA	biological process
GO:0022617	extracellular matrix disassembly	TAS	biological process
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0030203	glycosaminoglycan metabolic process	TAS	biological process
GO:0030206	chondroitin sulfate biosynthetic process	TAS	biological process
GO:0030207	chondroitin sulfate catabolic process	TAS	biological process
GO:0030208	dermatan sulfate biosynthetic process	TAS	biological process
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0042060	wound healing	IEA	biological process
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IGI	biological process
GO:0046426	negative regulation of JAK-STAT cascade	IBA	biological process
GO:0047485	protein N-terminus binding	IEA	molecular function
GO:0050840	extracellular matrix binding	IEA	molecular function
GO:0051901	positive regulation of mitochondrial depolarization	IGI	biological process
GO:0090141	positive regulation of mitochondrial fission	IGI	biological process
GO:1900747	negative regulation of vascular endothelial growth factor signaling pathway	IDA	biological process
GO:0031012	extracellular matrix	IDA	cellular component
GO:0031012	extracellular matrix	ISS	cellular component
GO:0001822	kidney development	IEA	biological process
GO:0001890	placenta development	IEA	biological process
GO:0004860	protein kinase inhibitor activity	IBA	molecular function
GO:0005518	collagen binding	IEA	molecular function
GO:0005518	collagen binding	IEA	molecular function
GO:0005539	glycosaminoglycan binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005578	proteinaceous extracellular matrix	IEA	cellular component
GO:0005578	proteinaceous extracellular matrix	IEA	cellular component
GO:0005578	proteinaceous extracellular matrix	IEA	cellular component
GO:0005589	collagen type VI trimer	IEA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0006469	negative regulation of protein kinase activity	IBA	biological process
GO:0007519	skeletal muscle tissue development	IEA	biological process
GO:0007568	aging	IEA	biological process
GO:0009612	response to mechanical stimulus	IEA	biological process
GO:0009887	animal organ morphogenesis	TAS	biological process
GO:0010508	positive regulation of autophagy	IDA	biological process
GO:0010596	negative regulation of endothelial cell migration	IDA	biological process
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IDA	biological process
GO:0016239	positive regulation of macroautophagy	IDA	biological process
GO:0016239	positive regulation of macroautophagy	IGI	biological process
GO:0016525	negative regulation of angiogenesis	IDA	biological process
GO:0019221	cytokine-mediated signaling pathway	IBA	biological process
GO:0019800	peptide cross-linking via chondroitin 4-sulfate glycosaminoglycan	IEA	biological process
GO:0022617	extracellular matrix disassembly	TAS	biological process
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0030203	glycosaminoglycan metabolic process	TAS	biological process
GO:0030206	chondroitin sulfate biosynthetic process	TAS	biological process
GO:0030207	chondroitin sulfate catabolic process	TAS	biological process
GO:0030208	dermatan sulfate biosynthetic process	TAS	biological process
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0042060	wound healing	IEA	biological process
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IGI	biological process
GO:0046426	negative regulation of JAK-STAT cascade	IBA	biological process
GO:0047485	protein N-terminus binding	IEA	molecular function
GO:0050840	extracellular matrix binding	IEA	molecular function
GO:0051901	positive regulation of mitochondrial depolarization	IGI	biological process
GO:0090141	positive regulation of mitochondrial fission	IGI	biological process
GO:1900747	negative regulation of vascular endothelial growth factor signaling pathway	IDA	biological process
GO:0031012	extracellular matrix	IDA	cellular component
GO:0031012	extracellular matrix	ISS	cellular component
GO:0004860	protein kinase inhibitor activity	IBA	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0006469	negative regulation of protein kinase activity	IBA	biological process
GO:0009887	animal organ morphogenesis	TAS	biological process
GO:0010508	positive regulation of autophagy	IDA	biological process
GO:0010596	negative regulation of endothelial cell migration	IDA	biological process
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IDA	biological process
GO:0016239	positive regulation of macroautophagy	IDA	biological process
GO:0016239	positive regulation of macroautophagy	IGI	biological process
GO:0016525	negative regulation of angiogenesis	IDA	biological process
GO:0019221	cytokine-mediated signaling pathway	IBA	biological process
GO:0022617	extracellular matrix disassembly	TAS	biological process
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0030203	glycosaminoglycan metabolic process	TAS	biological process
GO:0030206	chondroitin sulfate biosynthetic process	TAS	biological process
GO:0030207	chondroitin sulfate catabolic process	TAS	biological process
GO:0030208	dermatan sulfate biosynthetic process	TAS	biological process
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IGI	biological process
GO:0046426	negative regulation of JAK-STAT cascade	IBA	biological process
GO:0051901	positive regulation of mitochondrial depolarization	IGI	biological process
GO:0090141	positive regulation of mitochondrial fission	IGI	biological process
GO:1900747	negative regulation of vascular endothelial growth factor signaling pathway	IDA	biological process
GO:0031012	extracellular matrix	IDA	cellular component
GO:0031012	extracellular matrix	ISS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05205	Proteoglycans in cancer

Diseases

Associated diseases	References
Cancer	GAD: 19036156
Cancer (ovarian)	GAD: 20628624
Cancer (breast)	GAD: 19036156
Blood pressure	GAD: 19590686
Cardiovascular disease	GAD: 20445134
Myopia	GAD: 16902402
Diabetes	GAD: 12187087
Bone diseases	GAD: 19453261
Congenital stromal corneal dystrophy	KEGG: H00958
Male factor infertility	MIK: 21791437
Renal disease	GAD: 12187087
Male infertility	MIK: 21791437
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21791437	Male infertility				Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)