• Gene id: 1630

Gene Summary

• Gene Symbol: DCC   Gene   UCSC   Ensembl
• Aliases: CRC18, CRCR1, HGPPS2, IGDCC1, MRMV1, NTN1R1
• Gene name: DCC netrin 1 receptor
• Alternate names: netrin receptor DCC, colorectal cancer suppressor, deleted in colorectal carcinoma, immunoglobulin superfamily DCC subclass member 1, putative colorectal tumor suppressor, tumor suppressor protein DCC,
• Gene location: 18q21.2 (52340171: 53535898)     Exons: 4     NC_000018.10
• Gene summary(Entrez): This gene encodes a netrin 1 receptor. The transmembrane protein is a member of the immunoglobulin superfamily of cell adhesion molecules, and mediates axon guidance of neuronal growth cones towards sources of netrin 1 ligand. The cytoplasmic tail interac
• OMIM: 120470

Protein Summary

• Protein general information: P43146  
  • Name: Netrin receptor DCC (Colorectal cancer suppressor) (Immunoglobulin superfamily DCC subclass member 1) (Tumor suppressor protein DCC)
  • Length: 1447  
  • Mass: 158457
  • Tissue specificity: Found in axons of the central and peripheral nervous system and in differentiated cell types of the intestine. Not expressed in colorectal tumor cells that lost their capacity to differentiate into mucus producing cells. {ECO
• Sequence:

  MENSLRCVWVPKLAFVLFGASLFSAHLQVTGFQIKAFTALRFLSEPSDAVTMRGGNVLLDCSAESDRGVPVIKWK
  KDGIHLALGMDERKQQLSNGSLLIQNILHSRHHKPDEGLYQCEASLGDSGSIISRTAKVAVAGPLRFLSQTESVT
  AFMGDTVLLKCEVIGEPMPTIHWQKNQQDLTPIPGDSRVVVLPSGALQISRLQPGDIGIYRCSARNPASSRTGNE
  AEVRILSDPGLHRQLYFLQRPSNVVAIEGKDAVLECCVSGYPPPSFTWLRGEEVIQLRSKKYSLLGGSNLLISNV
  TDDDSGMYTCVVTYKNENISASAELTVLVPPWFLNHPSNLYAYESMDIEFECTVSGKPVPTVNWMKNGDVVIPSD
  YFQIVGGSNLRILGVVKSDEGFYQCVAENEAGNAQTSAQLIVPKPAIPSSSVLPSAPRDVVPVLVSSRFVRLSWR
  PPAEAKGNIQTFTVFFSREGDNRERALNTTQPGSLQLTVGNLKPEAMYTFRVVAYNEWGPGESSQPIKVATQPEL
  QVPGPVENLQAVSTSPTSILITWEPPAYANGPVQGYRLFCTEVSTGKEQNIEVDGLSYKLEGLKKFTEYSLRFLA
  YNRYGPGVSTDDITVVTLSDVPSAPPQNVSLEVVNSRSIKVSWLPPPSGTQNGFITGYKIRHRKTTRRGEMETLE
  PNNLWYLFTGLEKGSQYSFQVSAMTVNGTGPPSNWYTAETPENDLDESQVPDQPSSLHVRPQTNCIIMSWTPPLN
  PNIVVRGYIIGYGVGSPYAETVRVDSKQRYYSIERLESSSHYVISLKAFNNAGEGVPLYESATTRSITDPTDPVD
  YYPLLDDFPTSVPDLSTPMLPPVGVQAVALTHDAVRVSWADNSVPKNQKTSEVRLYTVRWRTSFSASAKYKSEDT
  TSLSYTATGLKPNTMYEFSVMVTKNRRSSTWSMTAHATTYEAAPTSAPKDLTVITREGKPRAVIVSWQPPLEANG
  KITAYILFYTLDKNIPIDDWIMETISGDRLTHQIMDLNLDTMYYFRIQARNSKGVGPLSDPILFRTLKVEHPDKM
  ANDQGRHGDGGYWPVDTNLIDRSTLNEPPIGQMHPPHGSVTPQKNSNLLVIIVVTVGVITVLVVVIVAVICTRRS
  SAQQRKKRATHSAGKRKGSQKDLRPPDLWIHHEEMEMKNIEKPSGTDPAGRDSPIQSCQDLTPVSHSQSETQLGS
  KSTSHSGQDTEEAGSSMSTLERSLAARRAPRAKLMIPMDAQSNNPAVVSAIPVPTLESAQYPGILPSPTCGYPHP
  QFTLRPVPFPTLSVDRGFGAGRSQSVSEGPTTQQPPMLPPSQPEHSSSEEAPSRTIPTACVRPTHPLRSFANPLL
  PPPMSAIEPKVPYTPLLSQPGPTLPKTHVKTASLGLAGKARSPLLPVSVPTAPEVSEESHKPTEDSANVYEQDDL
  SEQMASLEGLMKQLNAITGSAF

• Structural information:
  • Protein Domains: (26..13-)
    1 (/note="Ig-like-C2-type)
    (139..22-)
    2 (/note="Ig-like-C2-type)
    (234..32-)
    3 (/note="Ig-like-C2-type)
    (331..41-)
    4 (/note="Ig-like-C2-type)
    (431..52-)
    1 (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PR-)
  • Interpro: IPR033012  IPR003961  IPR036116  IPR007110  IPR036179   IPR013783  IPR013098  IPR003599  IPR003598  IPR010560  
  • Prosite: PS50853 PS50835
  • CDD: cd00063
  • PDB: 2ED7 2ED8 2ED9 2EDB 2EDD 2EDE 3AU4 4URT 5X83
  • PDBsum: 2ED7 2ED8 2ED9 2EDB 2EDD 2EDE 3AU4 4URT 5X83
  • DIP: 38423
  • STRING: ENSP00000389140
• Other Databases: GeneCards:  DCC  Malacards:  DCC

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005042	netrin receptor activity	IEA	molecular function
GO:0006915	apoptotic process	IEA	biological process
GO:0007399	nervous system development	IEA	biological process
GO:0007411	axon guidance	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004888	transmembrane signaling receptor activity	TAS	molecular function
GO:0006915	apoptotic process	TAS	biological process
GO:0007409	axonogenesis	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007411	axon guidance	TAS	biological process
GO:0097192	extrinsic apoptotic signaling pathway in absence of ligand	TAS	biological process
GO:1902842	negative regulation of netrin-activated signaling pathway	TAS	biological process
GO:1902842	negative regulation of netrin-activated signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0099170	postsynaptic modulation of chemical synaptic transmission	IEA	biological process
GO:0098685	Schaffer collateral - CA1 synapse	IEA	cellular component
GO:0033563	dorsal/ventral axon guidance	IEA	biological process
GO:0030424	axon	IEA	cellular component
GO:0001764	neuron migration	IEA	biological process
GO:0099061	integral component of postsynaptic density membrane	IEA	cellular component
GO:0033564	anterior/posterior axon guidance	IEA	biological process
GO:0021965	spinal cord ventral commissure morphogenesis	IEA	biological process
GO:0048671	negative regulation of collateral sprouting	TAS	biological process
GO:2000171	negative regulation of dendrite development	TAS	biological process
GO:0010977	negative regulation of neuron projection development	TAS	biological process
GO:0016020	membrane	IEA	cellular component
GO:0038007	netrin-activated signaling pathway	IEA	biological process
GO:1901214	regulation of neuron death	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04360	Axon guidance
hsa05210	Colorectal cancer

Diseases

Associated diseases	References
Colorectal cancer	KEGG:H00020
Cancer of the anal canal	KEGG:H00044
Colorectal cancer	KEGG:H00020
Cancer of the anal canal	KEGG:H00044
Congenital mirror movements	KEGG:H01287
Esophagus squamous cell carcinoma	PMID:8187090
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R