• Gene id: 1622

Gene Summary

• Gene Symbol: DBI   Gene   UCSC   Ensembl
• Aliases: ACBD1, ACBP, CCK-RP, EP
• Gene name: diazepam binding inhibitor, acyl-CoA binding protein
• Alternate names: acyl-CoA-binding protein, GABA receptor modulator, acyl coenzyme A binding protein, acyl-Coenzyme A binding domain containing 1, cholecystokinin-releasing peptide, trypsin-sensitive, diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein,
• Gene location: 2q14.2 (119366976: 119372559)     Exons: 7     NC_000002.12
• Gene summary(Entrez): This gene encodes diazepam binding inhibitor, a protein that is regulated by hormones and is involved in lipid metabolism and the displacement of beta-carbolines and benzodiazepines, which modulate signal transduction at type A gamma-aminobutyric acid rec
• OMIM: 125950

Protein Summary

• Protein general information: P07108  
  • Name: Acyl CoA binding protein (ACBP) (Diazepam binding inhibitor) (DBI) (Endozepine) (EP)
  • Length: 87  
  • Mass: 10044
  • Tissue specificity: Isoform 1 is ubiquitous, with a moderate expression level. Isoform 2 is ubiquitous with high level in liver and adipose tissue. Isoform 3 is ubiquitous with strong expression in adipose tissue and heart. {ECO
• Sequence:

  MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYI
  NKVEELKKKYGI

• Structural information:
  • Protein Domains: (2..8-)
    (/note="ACB-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00573"-)
  • Interpro: IPR022408  IPR000582  IPR035984  IPR014352  
  • Prosite: PS00880 PS51228
  • CDD: cd00435
  • PDB: 2CB8 2FJ9
  • PDBsum: 2CB8 2FJ9
  • STRING: ENSP00000439012
• Other Databases: GeneCards:  DBI  Malacards:  DBI

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000062	fatty-acyl-CoA binding	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0008289	lipid binding	IEA	molecular function
GO:0030156	benzodiazepine receptor binding	TAS	molecular function
GO:0006637	acyl-CoA metabolic process	TAS	biological process
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0036151	phosphatidylcholine acyl-chain remodeling	IDA	biological process
GO:0036042	long-chain fatty acyl-CoA binding	IDA	molecular function
GO:1903060	negative regulation of protein lipidation	IDA	biological process
GO:0032994	protein-lipid complex	IDA	cellular component
GO:2001140	positive regulation of phospholipid transport	IDA	biological process
GO:1905920	positive regulation of CoA-transferase activity	IDA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0042802	identical protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03320	PPAR signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881