• Gene id: 161882

Gene Summary

• Gene Symbol: ZFPM1   Gene   UCSC   Ensembl
• Aliases: FOG, FOG1, ZC2HC11A, ZNF408, ZNF89A
• Gene name: zinc finger protein, FOG family member 1
• Alternate names: zinc finger protein ZFPM1, FOG-1, friend of GATA 1, friend of GATA protein 1, zinc finger protein 89A, zinc finger protein, multitype 1,
• Gene location: 16q24.2 (88451781: 88537030)     Exons: 14     NC_000016.10

Protein Summary

• Protein general information: Q8IX07  
  • Name: Zinc finger protein ZFPM1 (Friend of GATA protein 1) (FOG 1) (Friend of GATA 1) (Zinc finger protein 89A) (Zinc finger protein multitype 1)
  • Length: 1006  
  • Mass: 104888
  • Tissue specificity: Mainly expressed in hematopoietic tissues. Also expressed in adult cerebellum, stomach, lymph node, liver and pancreas. Expressed in fetal heart, liver and spleen. {ECO
• Sequence:

  MSRRKQSNPRQIKRSLGDMEAREEVQLVGASHMEQKATAPEAPSPPSADVNSPPPLPPPTSPGGPKELEGQEPEP
  RPTEEEPGSPWSGPDELEPVVQDGQRRIRARLSLATGLSWGPFHGSVQTRASSPRQAEPSPALTLLLVDEACWLR
  TLPQALTEAEANTEIHRKDDALWCRVTKPVPAGGLLSVLLTAEPHSTPGHPVKKEPAEPTCPAPAHDLQLLPQQA
  GMASILATAVINKDVFPCKDCGIWYRSERNLQAHLLYYCASRQGTGSPAAAATDEKPKETYPNERVCPFPQCRKS
  CPSASSLEIHMRSHSGERPFVCLICLSAFTTKANCERHLKVHTDTLSGVCHSCGFISTTRDILYSHLVTNHMVCQ
  PGSKGEIYSPGAGHPATKLPPDSLGSFQQQHTALQGPLASADLGLAPTPSPGLDRKALAEATNGEARAEPLAQNG
  GSSEPPAAPRSIKVEAVEEPEAAPILGPGEPGPQAPSRTPSPRSPAPARVKAELSSPTPGSSPVPGELGLAGALF
  LPQYVFGPDAAPPASEILAKMSELVHSRLQQGAGAGAGGAQTGLFPGAPKGATCFECEITFSNVNNYYVHKRLYC
  SGRRAPEDAPAARRPKAPPGPARAPPGQPAEPDAPRSSPGPGAREEGAGGAATPEDGAGGRGSEGSQSPGSSVDD
  AEDDPSRTLCEACNIRFSRHETYTVHKRYYCASRHDPPPRRPAAPPGPPGPAAPPAPSPAAPVRTRRRRKLYELH
  AAGAPPPPPPGHAPAPESPRPGSGSGSGPGLAPARSPGPAADGPIDLSKKPRRPLPGAPAPALADYHECTACRVS
  FHSLEAYLAHKKYSCPAAPPPGALGLPAAACPYCPPNGPVRGDLLEHFRLAHGLLLGAPLAGPGVEARTPADRGP
  SPAPAPAASPQPGSRGPRDGLGPEPQEPPPGPPPSPAAAPEAVPPPPAPPSYSDKGVQTPSKGTPAPLPNGNHRY
  CRLCNIKFSSLSTFIAHKKYYCSSHAAEHVK

• Structural information:
  • Interpro: IPR039746  IPR034731  IPR036236  IPR013087  
  • Prosite: PS51810 PS00028 PS50157
  • PDB: 2XU7
  • PDBsum: 2XU7
  • DIP: 48415
  • STRING: ENSP00000326630
• Other Databases: GeneCards:  ZFPM1  Malacards:  ZFPM1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0001085	RNA polymerase II transcription factor binding	IBA	molecular function
GO:0030154	cell differentiation	IBA	biological process
GO:0030218	erythrocyte differentiation	IBA	biological process
GO:0030219	megakaryocyte differentiation	IBA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0007507	heart development	IBA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0001085	RNA polymerase II transcription factor binding	IEA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0007596	blood coagulation	TAS	biological process
GO:0045652	regulation of megakaryocyte differentiation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071733	transcriptional activation by promoter-enhancer looping	IEA	biological process
GO:0060413	atrial septum morphogenesis	IEA	biological process
GO:0060319	primitive erythrocyte differentiation	IEA	biological process
GO:0060318	definitive erythrocyte differentiation	IEA	biological process
GO:0055008	cardiac muscle tissue morphogenesis	IEA	biological process
GO:0045599	negative regulation of fat cell differentiation	IEA	biological process
GO:0032642	regulation of chemokine production	IEA	biological process
GO:0032091	negative regulation of protein binding	IEA	biological process
GO:0030851	granulocyte differentiation	IEA	biological process
GO:0030219	megakaryocyte differentiation	IEA	biological process
GO:0030218	erythrocyte differentiation	IEA	biological process
GO:0003192	mitral valve formation	IEA	biological process
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0060412	ventricular septum morphogenesis	IEA	biological process
GO:0060377	negative regulation of mast cell differentiation	IEA	biological process
GO:0048872	homeostasis of number of cells	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0035855	megakaryocyte development	IEA	biological process
GO:0035162	embryonic hemopoiesis	IEA	biological process
GO:0007507	heart development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003195	tricuspid valve formation	IEA	biological process
GO:0003181	atrioventricular valve morphogenesis	IEA	biological process
GO:0003151	outflow tract morphogenesis	IEA	biological process
GO:0001102	RNA polymerase II activating transcription factor binding	IEA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IGI	biological process
GO:0001085	RNA polymerase II transcription factor binding	IPI	molecular function
GO:0001085	RNA polymerase II transcription factor binding	IPI	molecular function
GO:0001085	RNA polymerase II transcription factor binding	IPI	molecular function
GO:0001085	RNA polymerase II transcription factor binding	IPI	molecular function
GO:0001085	RNA polymerase II transcription factor binding	IPI	molecular function
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific	IGI	molecular function
GO:0008134	transcription factor binding	IPI	molecular function
GO:0008134	transcription factor binding	IPI	molecular function
GO:0010724	regulation of definitive erythrocyte differentiation	IDA	biological process
GO:0045078	positive regulation of interferon-gamma biosynthetic process	IDA	biological process
GO:0002295	T-helper cell lineage commitment	IC	biological process
GO:0005667	transcription regulator complex	IDA	cellular component
GO:0017053	transcription repressor complex	IDA	cellular component
GO:0045403	negative regulation of interleukin-4 biosynthetic process	IDA	biological process
GO:0003192	mitral valve formation	ISS	biological process
GO:0010724	regulation of definitive erythrocyte differentiation	IMP	biological process
GO:0030218	erythrocyte differentiation	ISS	biological process
GO:0030219	megakaryocyte differentiation	ISS	biological process
GO:0030220	platelet formation	IGI	biological process
GO:0032091	negative regulation of protein binding	ISS	biological process
GO:0045599	negative regulation of fat cell differentiation	ISS	biological process
GO:0055008	cardiac muscle tissue morphogenesis	ISS	biological process
GO:0060413	atrial septum morphogenesis	ISS	biological process
GO:0071733	transcriptional activation by promoter-enhancer looping	ISS	biological process
GO:0003151	outflow tract morphogenesis	ISS	biological process
GO:0003181	atrioventricular valve morphogenesis	ISS	biological process
GO:0003195	tricuspid valve formation	ISS	biological process
GO:0035162	embryonic hemopoiesis	ISS	biological process
GO:0060377	negative regulation of mast cell differentiation	ISS	biological process
GO:0060412	ventricular septum morphogenesis	ISS	biological process
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray