• Gene id: 161742

Gene Summary

• Gene Symbol: SPRED1   Gene   UCSC   Ensembl
• Aliases: LGSS, NFLS, PPP1R147, hSpred1, spred-1
• Gene name: sprouty related EVH1 domain containing 1
• Alternate names: sprouty-related, EVH1 domain-containing protein 1, protein phosphatase 1, regulatory subunit 147, suppressor of Ras/MAPK activation,
• Gene location: 15q14 (188974372: 189012745)     Exons: 51     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the Sprouty family of proteins and is phosphorylated by tyrosine kinase in response to several growth factors. The encoded protein can act as a homodimer or as a heterodimer with SPRED2 to regulate activatio
• OMIM: 609291

Protein Summary

• Protein general information: Q7Z699  
  • Name: Sprouty related, EVH1 domain containing protein 1 (Spred 1) (hSpred1)
  • Length: 444  
  • Mass: 50477
  • Tissue specificity: Weakly expressed in embryonic cell line HEK293. {ECO
• Sequence:

  MSEETATSDNDNSYARVRAVVMTRDDSSGGWLPLGGSGLSSVTVFKVPHQEENGCADFFIRGERLRDKMVVLECM
  LKKDLIYNKVTPTFHHWKIDDKKFGLTFQSPADARAFDRGIRRAIEDISQGCPESKNEAEGADDLQANEEDSSSS
  LVKDHLFQQETVVTSEPYRSSNIRPSPFEDLNARRVYMQSQANQITFGQPGLDIQSRSMEYVQRQISKECGSLKS
  QNRVPLKSIRHVSFQDEDEIVRINPRDILIRRYADYRHPDMWKNDLERDDADSSIQFSKPDSKKSDYLYSCGDET
  KLSSPKDSVVFKTQPSSLKIKKSKRRKEDGERSRCVYCQERFNHEENVRGKCQDAPDPIKRCIYQVSCMLCAESM
  LYHCMSDSEGDFSDPCSCDTSDDKFCLRWLALVALSFIVPCMCCYVPLRMCHRCGEACGCCGGKHKAAG

• Structural information:
  • Protein Domains: (6..12-)
    (/note="WH1-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00410-)
    (233..28-)
    (/note="KBD-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00821-)
    (334..44-)
    (/note="SPR-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00572"-)
  • Interpro: IPR023337  IPR011993  IPR041937  IPR007875  IPR000697  
  • Prosite: PS51488 PS51227 PS50229
  • CDD: cd10574
  • PDB: 3SYX
  • PDBsum: 3SYX
  • STRING: ENSP00000299084
• Other Databases: GeneCards:  SPRED1  Malacards:  SPRED1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006469	negative regulation of protein kinase activity	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0031410	cytoplasmic vesicle	IDA	colocalizes with
GO:0019901	protein kinase binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0043408	regulation of MAPK cascade	TAS	biological process
GO:0016525	negative regulation of angiogenesis	IBA	biological process
GO:0010801	negative regulation of peptidyl-threonine phosphorylation	IBA	biological process
GO:0090311	regulation of protein deacetylation	IBA	biological process
GO:0043517	positive regulation of DNA damage response, signal transduction by p53 class mediator	IBA	biological process
GO:0019901	protein kinase binding	IBA	molecular function
GO:0000188	inactivation of MAPK activity	IBA	biological process
GO:0019902	phosphatase binding	IDA	molecular function
GO:0010923	negative regulation of phosphatase activity	IDA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0009966	regulation of signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0000165	MAPK cascade	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0010801	negative regulation of peptidyl-threonine phosphorylation	IEA	biological process
GO:0016525	negative regulation of angiogenesis	IEA	biological process
GO:0030291	protein serine/threonine kinase inhibitor activity	IEA	molecular function
GO:0090051	negative regulation of cell migration involved in sprouting angiogenesis	IEA	biological process
GO:0000188	inactivation of MAPK activity	IEA	biological process
GO:0005173	stem cell factor receptor binding	IEA	molecular function
GO:0019901	protein kinase binding	IEA	molecular function
GO:0043517	positive regulation of DNA damage response, signal transduction by p53 class mediator	IEA	biological process
GO:0070373	negative regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0090311	regulation of protein deacetylation	IEA	biological process
GO:0030291	protein serine/threonine kinase inhibitor activity	ISS	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0010801	negative regulation of peptidyl-threonine phosphorylation	IMP	biological process
GO:0043517	positive regulation of DNA damage response, signal transduction by p53 class mediator	ISS	biological process
GO:0090311	regulation of protein deacetylation	ISS	biological process
GO:0016525	negative regulation of angiogenesis	IMP	biological process
GO:0043409	negative regulation of MAPK cascade	IMP	biological process
GO:0060979	vasculogenesis involved in coronary vascular morphogenesis	IMP	biological process
GO:0005901	caveola	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005173	stem cell factor receptor binding	ISS	molecular function
GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway	ISS	biological process
GO:0070373	negative regulation of ERK1 and ERK2 cascade	ISS	biological process
GO:1902747	negative regulation of lens fiber cell differentiation	ISS	biological process
GO:0000188	inactivation of MAPK activity	ISS	biological process
GO:0010719	negative regulation of epithelial to mesenchymal transition	ISS	biological process

Diseases

Associated diseases	References
Legius syndrome	KEGG:H01986
Legius syndrome	KEGG:H01986
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)