• Gene id: 161725

Gene Summary

• Gene Symbol: OTUD7A   Gene   UCSC   Ensembl
• Aliases: C15orf16, C16ORF15, CEZANNE2, OTUD7
• Gene name: OTU deubiquitinase 7A
• Alternate names: OTU domain-containing protein 7A, OTU domain-containing 7A, cezanne 2, zinc finger protein Cezanne 2,
• Gene location: 15q13.3 (92325993: 92297357)     Exons: 20     NC_000009.12
• Gene summary(Entrez): The protein encoded by this gene is a deubiquitinizing enzyme and possible tumor suppressor. The encoded protein acts on TNF receptor associated factor 6 (TRAF6) to control nuclear factor kappa B expression. However, this gene is downregulated by SNAIL1 i
• OMIM: 612024

Protein Summary

• Protein general information: Q8TE49  
  • Name: OTU domain containing protein 7A (EC 3.4.19.12) (Zinc finger protein Cezanne 2)
  • Length: 926  
  • Mass: 100677
• Sequence:

  MVSSVLPNPTSAECWAALLHDPMTLDMDAVLSDFVRSTGAEPGLARDLLEGKNWDLTAALSDYEQLRQVHTANLP
  HVFNEGRGPKQPEREPQPGHKVERPCLQRQDDIAQEKRLSRGISHASSAIVSLARSHVASECNNEQFPLEMPIYT
  FQLPDLSVYSEDFRSFIERDLIEQATMVALEQAGRLNWWSTVCTSCKRLLPLATTGDGNCLLHAASLGMWGFHDR
  DLVLRKALYTMMRTGAEREALKRRWRWQQTQQNKEEEWEREWTELLKLASSEPRTHFSKNGGTGGGVDNSEDPVY
  ESLEEFHVFVLAHILRRPIVVVADTMLRDSGGEAFAPIPFGGIYLPLEVPPNRCHCSPLVLAYDQAHFSALVSME
  QRDQQREQAVIPLTDSEHKLLPLHFAVDPGKDWEWGKDDNDNARLAHLILSLEAKLNLLHSYMNVTWIRIPSETR
  APLAQPESPTASAGEDVQSLADSLDSDRDSVCSNSNSNNGKNGKDKEKEKQRKEKDKTRADSVANKLGSFSKTLG
  IKLKKNMGGLGGLVHGKMGRANSANGKNGDSAERGKEKKAKSRKGSKEESGASASTSPSEKTTPSPTDKAAGASP
  AEKGGGPRGDAWKYSTDVKLSLNILRAAMQGERKFIFAGLLLTSHRHQFHEEMIGYYLTSAQERFSAEQEQRRRD
  AATAAAAAAAAAAATAKRPPRRPETEGVPVPERASPGPPTQLVLKLKERPSPGPAAGRAARAAAGGTASPGGGAR
  RASASGPVPGRSPPAPARQSVIHVQASGARDEACAPAVGALRPCATYPQQNRSLSSQSYSPARAAALRTVNTVES
  LARAVPGALPGAAGTAGAAEHKSQTYTNGFGALRDGLEFADADAPTARSNGECGRGGPGPVQRRCQRENCAFYGR
  AETEHYCSYCYREELRRRREARGARP

• Structural information:
  • Protein Domains: (199..37-)
    (/note="OTU-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00139"-)
  • Interpro: IPR033477  IPR003323  IPR002653  
  • Prosite: PS50802 PS51036
  • PDB: 2L2D
  • PDBsum: 2L2D
  • STRING: ENSP00000305926
• Other Databases: GeneCards:  OTUD7A  Malacards:  OTUD7A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IBA	molecular function
GO:0035871	protein K11-linked deubiquitination	IBA	biological process
GO:0043124	negative regulation of I-kappaB kinase/NF-kappaB signaling	IBA	biological process
GO:0070536	protein K63-linked deubiquitination	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0070530	K63-linked polyubiquitin modification-dependent protein binding	IBA	molecular function
GO:0071108	protein K48-linked deubiquitination	IBA	biological process
GO:0071947	protein deubiquitination involved in ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0035871	protein K11-linked deubiquitination	IDA	biological process
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IDA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0035871	protein K11-linked deubiquitination	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	IEA	molecular function
GO:0016579	protein deubiquitination	TAS	biological process
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq