• Gene id: 161291

Gene Summary

• Gene Symbol: TMEM30B   Gene   UCSC   Ensembl
• Aliases: CDC50B
• Gene name: transmembrane protein 30B
• Alternate names: cell cycle control protein 50B, P4-ATPase flippase complex beta subunit TMEM30B,
• Gene location: 14q23.1 (61281337: 61277369)     Exons: 1     NC_000014.9
• OMIM: 611029

Protein Summary

• Protein general information: Q3MIR4  
  • Name: Cell cycle control protein 50B (P4 ATPase flippase complex beta subunit TMEM30B) (Transmembrane protein 30B)
  • Length: 351  
  • Mass: 38941
• Sequence:

  MTWSATARGAHQPDNTAFTQQRLPAWQPLLSASIALPLFFCAGLAFIGLGLGLYYSSNGIKELEYDYTGDPGTGN
  CSVCAAAGQGRALPPPCSCAWYFSLPELFQGPVYLYYELTNFYQNNRRYGVSRDDAQLSGLPSALRHPVNECAPY
  QRSAAGLPIAPCGAIANSLFNDSFSLWHQRQPGGPYVEVPLDRSGIAWWTDYHVKFRNPPLVNGSLALAFQGTAP
  PPNWRRPVYELSPDPNNTGFINQDFVVWMRTAALPTFRKLYARIRQGNYSAGLPRGAYRVNITYNYPVRAFGGHK
  LLIFSSISWMGGKNPFLGIAYLVVGSLCILTGFVMLVVYIRYQDQDDDDEE

• Structural information:
  • Interpro: IPR005045  IPR030352  
  • STRING: ENSP00000450842
• Other Databases: GeneCards:  TMEM30B  Malacards:  TMEM30B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0016020	membrane	IBA	cellular component
GO:0045332	phospholipid translocation	IBA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006869	lipid transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0015247	aminophospholipid flippase activity	IDA	molecular function
GO:0015917	aminophospholipid transport	IDA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0140331	aminophospholipid translocation	IEA	biological process
GO:0070863	positive regulation of protein exit from endoplasmic reticulum	IDA	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)