• Gene id: 161253

Gene Summary

• Gene Symbol: REM2   Gene   UCSC   Ensembl
• Gene name: RRAD and GEM like GTPase 2
• Alternate names: GTP-binding protein REM 2, RAS (RAD and GEM)-like GTP binding 2, RAS-like GTP binding 2, Rad and Gem-related 2 (rat homolog), rad and Gem-like GTP-binding protein 2,
• Gene location: 14q11.2 (22883164: 22887677)     Exons: 5     NC_000014.9
• OMIM: 616955

Protein Summary

• Protein general information: Q8IYK8  
  • Name: GTP binding protein REM 2 (Rad and Gem like GTP binding protein 2)
  • Length: 340  
  • Mass: 37139
• Sequence:

  MHTDLDTDMDMDTETTALCPSGSRRASPPGTPTPEADATLLKKSEKLLAELDRSGLPSAPGAPRRRGSMPVPYKH
  QLRRAQAVDELDWPPQASSSGSSDSLGSGEAAPAQKDGIFKVMLVGESGVGKSTLAGTFGGLQGDSAHEPENPED
  TYERRIMVDKEEVTLVVYDIWEQGDAGGWLRDHCLQTGDAFLIVFSVTDRRSFSKVPETLLRLRAGRPHHDLPVI
  LVGNKSDLARSREVSLEEGRHLAGTLSCKHIETSAALHHNTRELFEGAVRQIRLRRGRNHAGGQRPDPGSPEGPA
  PPARRESLTKKAKRFLANLVPRNAKFFKQRSRSCHDLSVL

• Structural information:
  • Interpro: IPR027417  IPR017358  IPR025662  IPR001806  IPR020849  
  • Prosite: PS51421
  • PDB: 3CBQ
  • PDBsum: 3CBQ
  • STRING: ENSP00000267396
• Other Databases: GeneCards:  REM2  Malacards:  REM2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005246	calcium channel regulator activity	IBA	molecular function
GO:0005525	GTP binding	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0003924	GTPase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq