• Gene id: 161247

Gene Summary

• Gene Symbol: FITM1   Gene   UCSC   Ensembl
• Aliases: FIT1
• Gene name: fat storage inducing transmembrane protein 1
• Alternate names: fat storage-inducing transmembrane protein 1, fat-inducing protein 1, fat-inducing transcript 1,
• Gene location: 14q12 (24131465: 24132848)     Exons: 2     NC_000014.9
• Gene summary(Entrez): FIT1 belongs to an evolutionarily conserved family of proteins involved in fat storage (Kadereit et al., 2008 [PubMed 18160536]).[supplied by OMIM, May 2008]
• OMIM: 612028

Protein Summary

• Protein general information: A5D6W6  
  • Name: Fat storage inducing transmembrane protein 1 (Fat inducing protein 1)
  • Length: 292  
  • Mass: 32207
  • Tissue specificity: Primarily expressed in heart and skeletal muscle. {ECO
• Sequence:

  MERGPVVGAGLGAGARIQALLGCLLKVLLWVASALLYFGSEQAARLLGSPCLRRLYHAWLAAVVIFGPLLQFHVN
  PRTIFASHGNFFNIKFVNSAWGWTCTFLGGFVLLVVFLATRRVAVTARHLSRLVVGAAVWRGAGRAFLLIEDLTG
  SCFEPLPQGLLLHELPDRRSCLAAGHQWRGYTVSSHTFLLTFCCLLMAEEAAVFAKYLAHGLPAGAPLRLVFLLN
  VLLLGLWNFLLLCTVIYFHQYTHKVVGAAVGTFAWYLTYGSWYHQPWSPGSPGHGLFPRPHSSRKHN

• Structural information:
  • Interpro: IPR019388  
  • STRING: ENSP00000267426
• Other Databases: GeneCards:  FITM1  Malacards:  FITM1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008654	phospholipid biosynthetic process	IBA	biological process
GO:0019915	lipid storage	IBA	biological process
GO:0034389	lipid droplet organization	IBA	biological process
GO:0030176	integral component of endoplasmic reticulum membrane	IBA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0019915	lipid storage	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0034389	lipid droplet organization	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0030176	integral component of endoplasmic reticulum membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0034389	lipid droplet organization	IEA	biological process
GO:0010890	positive regulation of sequestering of triglyceride	IEA	biological process
GO:0003674	molecular_function	ND	molecular function
GO:0005789	endoplasmic reticulum membrane	ISS	cellular component
GO:0010890	positive regulation of sequestering of triglyceride	ISS	biological process
GO:0034389	lipid droplet organization	ISS	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881