• Gene id: 1612

Gene Summary

• Gene Symbol: DAPK1   Gene   UCSC   Ensembl
• Aliases: DAPK, ROCO3
• Gene name: death associated protein kinase 1
• Alternate names: death-associated protein kinase 1, DAP kinase 1,
• Gene location: 9q21.33 (87497227: 87708633)     Exons: 31     NC_000009.12
• Gene summary(Entrez): Death-associated protein kinase 1 is a positive mediator of gamma-interferon induced programmed cell death. DAPK1 encodes a structurally unique 160-kD calmodulin dependent serine-threonine kinase that carries 8 ankyrin repeats and 2 putative P-loop consen
• OMIM: 609329

Protein Summary

• Protein general information: P53355  
  • Name: Death associated protein kinase 1 (DAP kinase 1) (EC 2.7.11.1)
  • Length: 1430  
  • Mass: 160046
  • Tissue specificity: Isoform 2 is expressed in normal intestinal tissue as well as in colorectal carcinomas. {ECO
• Sequence:

  MTVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTKSSRRGVSREDIEREVSILKEIQHPN
  VITLHEVYENKTDVILILELVAGGELFDFLAEKESLTEEEATEFLKQILNGVYYLHSLQIAHFDLKPENIMLLDR
  NVPKPRIKIIDFGLAHKIDFGNEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQET
  LANVSAVNYEFEDEYFSNTSALAKDFIRRLLVKDPKKRMTIQDSLQHPWIKPKDTQQALSRKASAVNMEKFKKFA
  ARKKWKQSVRLISLCQRLSRSFLSRSNMSVARSDDTLDEEDSFVMKAIIHAINDDNVPGLQHLLGSLSNYDVNQP
  NKHGTPPLLIAAGCGNIQILQLLIKRGSRIDVQDKGGSNAVYWAARHGHVDTLKFLSENKCPLDVKDKSGEMALH
  VAARYGHADVAQLLCSFGSNPNIQDKEEETPLHCAAWHGYYSVAKALCEAGCNVNIKNREGETPLLTASARGYHD
  IVECLAEHGADLNACDKDGHIALHLAVRRCQMEVIKTLLSQGCFVDYQDRHGNTPLHVACKDGNMPIVVALCEAN
  CNLDISNKYGRTPLHLAANNGILDVVRYLCLMGASVEALTTDGKTAEDLARSEQHEHVAGLLARLRKDTHRGLFI
  QQLRPTQNLQPRIKLKLFGHSGSGKTTLVESLKCGLLRSFFRRRRPRLSSTNSSRFPPSPLASKPTVSVSINNLY
  PGCENVSVRSRSMMFEPGLTKGMLEVFVAPTHHPHCSADDQSTKAIDIQNAYLNGVGDFSVWEFSGNPVYFCCYD
  YFAANDPTSIHVVVFSLEEPYEIQLNQVIFWLSFLKSLVPVEEPIAFGGKLKNPLQVVLVATHADIMNVPRPAGG
  EFGYDKDTSLLKEIRNRFGNDLHISNKLFVLDAGASGSKDMKVLRNHLQEIRSQIVSVCPPMTHLCEKIISTLPS
  WRKLNGPNQLMSLQQFVYDVQDQLNPLASEEDLRRIAQQLHSTGEINIMQSETVQDVLLLDPRWLCTNVLGKLLS
  VETPRALHHYRGRYTVEDIQRLVPDSDVEELLQILDAMDICARDLSSGTMVDVPALIKTDNLHRSWADEEDEVMV
  YGGVRIVPVEHLTPFPCGIFHKVQVNLCRWIHQQSTEGDADIRLWVNGCKLANRGAELLVLLVNHGQGIEVQVRG
  LETEKIKCCLLLDSVCSTIENVMATTLPGLLTVKHYLSPQQLREHHEPVMIYQPRDFFRAQTLKETSLTNTMGGY
  KESFSSIMCFGCHDVYSQASLGMDIHASDLNLLTRRKLSRLLDPPDPLGKDWCLLAMNLGLPDLVAKYNTSNGAP
  KDFLPSPLHALLREWTTYPESTVGTLMSKLRELGRRDAADFLLKASSVFKINLDGNGQEAYASSCNSGTSYNSIS
  SVVSR

• Structural information:
  • Protein Domains: (13..27-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159-)
    (681..95-)
    (/note="Roc-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00758-)
    (1312..139-)
    (/note="Death-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU000-)
  • Interpro: IPR002110  IPR020683  IPR036770  IPR020676  IPR011029   IPR000488  IPR011009  IPR027417  IPR000719  IPR017441  IPR020859  IPR008271  
  • Prosite: PS50297 PS50088 PS50017 PS00107 PS50011 PS00108 PS51424
  • PDB: 1IG1 1JKK 1JKL 1JKS 1JKT 1P4F 1WVW 1WVX 1WVY 1YR5 2W4J 2W4K 2X0G 2XUU 2XZS 2Y0A 2Y4P 2Y4V 2YAK 3DFC 3DGK 3EH9 3EHA 3F5G 3F5U 3GU4 3GU5 3GU6 3GU7 3GU8 3GUB 3ZXT 4B4L 4PF4 4TL0 4TXC 4UV0 4YO4 4YPD 5AUT 5AUU 5AUV 5AUW 5AUX 5AUY 5AUZ 5AV0 5AV1 5AV2 5AV3 5AV4 6AAR 6FHA 6FHB 6GY5 6IN4 6QMO 6QN4
  • PDBsum: 1IG1 1JKK 1JKL 1JKS 1JKT 1P4F 1WVW 1WVX 1WVY 1YR5 2W4J 2W4K 2X0G 2XUU 2XZS 2Y0A 2Y4P 2Y4V 2YAK 3DFC 3DGK 3EH9 3EHA 3F5G 3F5U 3GU4 3GU5 3GU6 3GU7 3GU8 3GUB 3ZXT 4B4L 4PF4 4TL0 4TXC 4UV0 4YO4 4YPD 5AUT 5AUU 5AUV 5AUW 5AUX 5AUY 5AUZ 5AV0 5AV1 5AV2 5AV3 5AV4 6AAR 6FHA 6FHB 6GY5 6IN4 6QMO 6QN4
  • STRING: ENSP00000386135
• Other Databases: GeneCards:  DAPK1  Malacards:  DAPK1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071447	cellular response to hydroperoxide	IMP	biological process
GO:0010508	positive regulation of autophagy	IMP	biological process
GO:0043065	positive regulation of apoptotic process	IBA	biological process
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0071346	cellular response to interferon-gamma	IDA	biological process
GO:0017148	negative regulation of translation	IDA	biological process
GO:0046777	protein autophosphorylation	TAS	biological process
GO:0010506	regulation of autophagy	TAS	biological process
GO:2000310	regulation of NMDA receptor activity	ISS	biological process
GO:0042981	regulation of apoptotic process	TAS	biological process
GO:0006468	protein phosphorylation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0006417	regulation of translation	IEA	biological process
GO:0005525	GTP binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0005516	calmodulin binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0006915	apoptotic process	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0004672	protein kinase activity	IDA	molecular function
GO:0006915	apoptotic process	IGI	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005516	calmodulin binding	IEA	molecular function
GO:0008625	extrinsic apoptotic signaling pathway via death domain receptors	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0071346	cellular response to interferon-gamma	IEA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006468	protein phosphorylation	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:2000310	regulation of NMDA receptor activity	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0004672	protein kinase activity	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0035556	intracellular signal transduction	IDA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0015629	actin cytoskeleton	IDA	cellular component
GO:0005516	calmodulin binding	IDA	molecular function
GO:0004683	calmodulin-dependent protein kinase activity	IDA	molecular function
GO:0005524	ATP binding	IDA	molecular function
GO:0043280	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0017075	syntaxin-1 binding	IPI	molecular function
GO:0097190	apoptotic signaling pathway	IMP	biological process
GO:0006915	apoptotic process	IMP	biological process
GO:0071447	cellular response to hydroperoxide	IMP	biological process
GO:0010508	positive regulation of autophagy	IMP	biological process
GO:0043065	positive regulation of apoptotic process	IBA	biological process
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0071346	cellular response to interferon-gamma	IDA	biological process
GO:0017148	negative regulation of translation	IDA	biological process
GO:0046777	protein autophosphorylation	TAS	biological process
GO:0010506	regulation of autophagy	TAS	biological process
GO:2000310	regulation of NMDA receptor activity	ISS	biological process
GO:0042981	regulation of apoptotic process	TAS	biological process
GO:0006468	protein phosphorylation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0006417	regulation of translation	IEA	biological process
GO:0005525	GTP binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0005516	calmodulin binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0006915	apoptotic process	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0004672	protein kinase activity	IDA	molecular function
GO:0006915	apoptotic process	IGI	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005516	calmodulin binding	IEA	molecular function
GO:0008625	extrinsic apoptotic signaling pathway via death domain receptors	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0071346	cellular response to interferon-gamma	IEA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006468	protein phosphorylation	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:2000310	regulation of NMDA receptor activity	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0004672	protein kinase activity	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0035556	intracellular signal transduction	IDA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0015629	actin cytoskeleton	IDA	cellular component
GO:0005516	calmodulin binding	IDA	molecular function
GO:0004683	calmodulin-dependent protein kinase activity	IDA	molecular function
GO:0005524	ATP binding	IDA	molecular function
GO:0043280	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0017075	syntaxin-1 binding	IPI	molecular function
GO:0097190	apoptotic signaling pathway	IMP	biological process
GO:0006915	apoptotic process	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04140	Autophagy - animal
hsa05219	Bladder cancer

Diseases

Associated diseases	References
Bladder cancer	KEGG:H00022
Bladder cancer	KEGG:H00022
urinary bladder cancer	PMID:12124340
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq