• Gene id: 161198

Gene Summary

• Gene Symbol: CLEC14A   Gene   UCSC   Ensembl
• Aliases: C14orf27, CEG1, EGFR-5
• Gene name: C-type lectin domain containing 14A
• Alternate names: C-type lectin domain family 14 member A, ClECT and EGF-like domain containing protein, epidermal growth factor receptor 5,
• Gene location: 14q21.1 (38256092: 38253999)     Exons: 1     NC_000014.9
• Gene summary(Entrez): This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles
• OMIM: 616845

Protein Summary

• Protein general information: Q86T13  
  • Name: C type lectin domain family 14 member A (Epidermal growth factor receptor 5) (EGFR 5)
  • Length: 490  
  • Mass: 51636
• Sequence:

  MRPAFALCLLWQALWPGPGGGEHPTADRAGCSASGACYSLHHATMKRQAAEEACILRGGALSTVRAGAELRAVLA
  LLRAGPGPGGGSKDLLFWVALERRRSHCTLENEPLRGFSWLSSDPGGLESDTLQWVEEPQRSCTARRCAVLQATG
  GVEPAGWKEMRCHLRANGYLCKYQFEVLCPAPRPGAASNLSYRAPFQLHSAALDFSPPGTEVSALCRGQLPISVT
  CIADEIGARWDKLSGDVLCPCPGRYLRAGKCAELPNCLDDLGGFACECATGFELGKDGRSCVTSGEGQPTLGGTG
  VPTRRPPATATSPVPQRTWPIRVDEKLGETPLVPEQDNSVTSIPEIPRWGSQSTMSTLQMSLQAESKATITPSGS
  VISKFNSTTSSATPQAFDSSSAVVFIFVSTAVVVLVILTMTVLGLVKLCFHESPSSQPRKESMGPPGLESDPEPA
  ALGSSSAHCTNNGVKVGDCDLRDRAEGALLAESPLGSSDA

• Structural information:
  • Protein Domains: (33..17-)
    (/note="C-type-lectin)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00040-)
    (245..28-)
    (/note="EGF-like"-)
  • Interpro: IPR001304  IPR016186  IPR016187  
  • Prosite: PS00010 PS50041 PS01186
  • STRING: ENSP00000353013
• Other Databases: GeneCards:  CLEC14A  Malacards:  CLEC14A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1990430	extracellular matrix protein binding	IBA	molecular function
GO:0050840	extracellular matrix binding	IBA	molecular function
GO:0016477	cell migration	IBA	biological process
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:1990430	extracellular matrix protein binding	IDA	molecular function
GO:0009897	external side of plasma membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0002042	cell migration involved in sprouting angiogenesis	IEA	biological process
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0036324	vascular endothelial growth factor receptor-2 signaling pathway	IMP	biological process
GO:0036325	vascular endothelial growth factor receptor-3 signaling pathway	IMP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881