• Gene id: 1611

Gene Summary

• Gene Symbol: DAP   Gene   UCSC   Ensembl
• Gene name: death associated protein
• Alternate names: death-associated protein 1, DAP-1,
• Gene location: 5p15.2 (10761233: 10679229)     Exons: 4     NC_000005.10
• Gene summary(Entrez): This gene encodes a basic, proline-rich, 15-kD protein. The protein acts as a positive mediator of programmed cell death that is induced by interferon-gamma. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gen
• OMIM: 600954

Protein Summary

• Protein general information: P51397  
  • Name: Death associated protein 1 (DAP 1)
  • Length: 102  
  • Mass: 11165
• Sequence:

  MSSPPEGKLETKAGHPPAVKAGGMRIVQKHPHTGDTKEEKDKDDQEWESPSPPKPTVFISGVIARGDKDFPPAAA
  QVAHQKPHASMDKHPSPRTQHIQQPRK

• Structural information:
  • Interpro: IPR024130  
  • STRING: ENSP00000230895
• Other Databases: GeneCards:  DAP  Malacards:  DAP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070513	death domain binding	IBA	molecular function
GO:0010507	negative regulation of autophagy	IBA	biological process
GO:0097190	apoptotic signaling pathway	IBA	biological process
GO:0034198	cellular response to amino acid starvation	IBA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0006914	autophagy	IEA	biological process
GO:0006915	apoptotic process	IGI	biological process
GO:0034198	cellular response to amino acid starvation	IDA	biological process
GO:0097190	apoptotic signaling pathway	IMP	biological process
GO:0070513	death domain binding	IPI	molecular function
GO:0032088	negative regulation of NF-kappaB transcription factor activity	IMP	biological process
GO:0097190	apoptotic signaling pathway	IMP	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IMP	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IMP	biological process
GO:0010507	negative regulation of autophagy	IMP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray