• Gene id: 1610

Gene Summary

• Gene Symbol: DAO   Gene   UCSC   Ensembl
• Aliases: DAAO, DAMOX, OXDA
• Gene name: D-amino acid oxidase
• Alternate names: D-amino-acid oxidase,
• Gene location: 12q24.11 (108880029: 108901042)     Exons: 12     NC_000012.12
• Gene summary(Entrez): This gene encodes the peroxisomal enzyme D-amino acid oxidase. The enzyme is a flavoprotein which uses flavin adenine dinucleotide (FAD) as its prosthetic group. Its substrates include a wide variety of D-amino acids, but it is inactive on the naturally o
• OMIM: 124050

Protein Summary

• Protein general information: P14920  
  • Name: D amino acid oxidase (DAAO) (DAMOX) (DAO) (EC 1.4.3.3)
  • Length: 347  
  • Mass: 39,474
• Sequence:

  MRVVVIGAGVIGLSTALCIHERYHSVLQPLDIKVYADRFTPLTTTDVAAGLWQPYLSDPNNPQEADWSQQTFDYL
  LSHVHSPNAENLGLFLISGYNLFHEAIPDPSWKDTVLGFRKLTPRELDMFPDYGYGWFHTSLILEGKNYLQWLTE
  RLTERGVKFFQRKVESFEEVAREGADVIVNCTGVWAGALQRDPLLQPGRGQIMKVDAPWMKHFILTHDPERGIYN
  SPYIIPGTQTVTLGGIFQLGNWSELNNIQDHNTIWEGCCRLEPTLKNARIIGERTGFRPVRPQIRLEREQLRTGP
  SNTEVIHNYGHGGYGLTIHWGCALEAAKLFGRILEEKKLSRMPPSHL

• Structural information:
  • Interpro: IPR006181  IPR023209  IPR006076  
  • Prosite: PS00677
  • PDB: 2DU8 2E48 2E49 2E4A 2E82 2GNZ 3CUK 3G3E 3W4I 3W4J 3W4K 3ZNN 3ZNO 3ZNP 3ZNQ 4QFC 4QFD
  • PDBsum: 2DU8 2E48 2E49 2E4A 2E82 2GNZ 3CUK 3G3E 3W4I 3W4J 3W4K 3ZNN 3ZNO 3ZNP 3ZNQ 4QFC 4QFD
  • STRING: ENSP00000228476
• Other Databases: GeneCards:  DAO  Malacards:  DAO

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003884	D-amino-acid oxidase activity	IDA	molecular function
GO:0003884	D-amino-acid oxidase activity	IDA	molecular function
GO:0003884	D-amino-acid oxidase activity	IDA	molecular function
GO:0003884	D-amino-acid oxidase activity	IDA	molecular function
GO:0003884	D-amino-acid oxidase activity	IDA	molecular function
GO:0003884	D-amino-acid oxidase activity	IDA	molecular function
GO:0003884	D-amino-acid oxidase activity	TAS	molecular function
GO:0005102	receptor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005777	peroxisome	IDA	cellular component
GO:0005778	peroxisomal membrane	IDA	cellular component
GO:0005782	peroxisomal matrix	TAS	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0006562	proline catabolic process	IDA	biological process
GO:0036088	D-serine catabolic process	IDA	biological process
GO:0042416	dopamine biosynthetic process	IDA	biological process
GO:0046487	glyoxylate metabolic process	TAS	biological process
GO:0046983	protein dimerization activity	IDA	molecular function
GO:0046983	protein dimerization activity	IDA	molecular function
GO:0048037	cofactor binding	IDA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0055130	D-alanine catabolic process	IDA	biological process
GO:0055130	D-alanine catabolic process	IDA	biological process
GO:0070178	D-serine metabolic process	IDA	biological process
GO:0071949	FAD binding	IDA	molecular function
GO:0071949	FAD binding	IDA	molecular function
GO:0071949	FAD binding	IDA	molecular function
GO:0005741	mitochondrial outer membrane	IDA	cellular component
GO:0003884	D-amino-acid oxidase activity	IEA	molecular function
GO:0003884	D-amino-acid oxidase activity	IEA	molecular function
GO:0003884	D-amino-acid oxidase activity	IDA	molecular function
GO:0003884	D-amino-acid oxidase activity	IDA	molecular function
GO:0003884	D-amino-acid oxidase activity	IDA	molecular function
GO:0003884	D-amino-acid oxidase activity	IDA	molecular function
GO:0003884	D-amino-acid oxidase activity	IDA	molecular function
GO:0003884	D-amino-acid oxidase activity	IDA	molecular function
GO:0003884	D-amino-acid oxidase activity	TAS	molecular function
GO:0005102	receptor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005777	peroxisome	IEA	cellular component
GO:0005777	peroxisome	IEA	cellular component
GO:0005777	peroxisome	IDA	cellular component
GO:0005778	peroxisomal membrane	IDA	cellular component
GO:0005782	peroxisomal matrix	TAS	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0006562	proline catabolic process	IDA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0036088	D-serine catabolic process	IDA	biological process
GO:0042416	dopamine biosynthetic process	IDA	biological process
GO:0046416	D-amino acid metabolic process	IEA	biological process
GO:0046487	glyoxylate metabolic process	TAS	biological process
GO:0046983	protein dimerization activity	IDA	molecular function
GO:0046983	protein dimerization activity	IDA	molecular function
GO:0048037	cofactor binding	IDA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0055130	D-alanine catabolic process	IDA	biological process
GO:0055130	D-alanine catabolic process	IDA	biological process
GO:0070178	D-serine metabolic process	IDA	biological process
GO:0071949	FAD binding	IEA	molecular function
GO:0071949	FAD binding	IDA	molecular function
GO:0071949	FAD binding	IDA	molecular function
GO:0071949	FAD binding	IDA	molecular function
GO:0005741	mitochondrial outer membrane	IDA	cellular component
GO:0003884	D-amino-acid oxidase activity	IDA	molecular function
GO:0003884	D-amino-acid oxidase activity	IDA	molecular function
GO:0003884	D-amino-acid oxidase activity	IDA	molecular function
GO:0003884	D-amino-acid oxidase activity	IDA	molecular function
GO:0003884	D-amino-acid oxidase activity	IDA	molecular function
GO:0003884	D-amino-acid oxidase activity	IDA	molecular function
GO:0003884	D-amino-acid oxidase activity	TAS	molecular function
GO:0005102	receptor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005777	peroxisome	IDA	cellular component
GO:0005778	peroxisomal membrane	IDA	cellular component
GO:0005782	peroxisomal matrix	TAS	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0006562	proline catabolic process	IDA	biological process
GO:0036088	D-serine catabolic process	IDA	biological process
GO:0042416	dopamine biosynthetic process	IDA	biological process
GO:0046487	glyoxylate metabolic process	TAS	biological process
GO:0046983	protein dimerization activity	IDA	molecular function
GO:0046983	protein dimerization activity	IDA	molecular function
GO:0048037	cofactor binding	IDA	molecular function
GO:0055130	D-alanine catabolic process	IDA	biological process
GO:0055130	D-alanine catabolic process	IDA	biological process
GO:0070178	D-serine metabolic process	IDA	biological process
GO:0071949	FAD binding	IDA	molecular function
GO:0071949	FAD binding	IDA	molecular function
GO:0071949	FAD binding	IDA	molecular function
GO:0005741	mitochondrial outer membrane	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04146	Peroxisome

Diseases

Associated diseases	References
Celiac disease	GAD: 19240061
Crohn's disease	GAD: 19670078
Hypercholesterolemia	GAD: 20602615
Schizophrenia	GAD: 124050
Autism	GAD: 17629951
Bipolar disorder	GAD: 18165970
Cognitive function	GAD: 17336946
Asthenozoospermia	MIK: 7657754
Azoospermia	MIK: 7657754
Male factor infertility	MIK: 7657754
Male factor infertility	MIK: 2508450
Oligoasthenozoospermia	MIK: 7657754
Sperm motility	MIK: 2508450
Asthenozoospermia	MIK: 7657754
Oligoasthenozoospermia	MIK: 7657754
Azoospermia	MIK: 7657754
Male infertility	MIK: 2508450
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
7657754	Asthenozoospermia, oligoasthenozoospermia, azoospermia			139 (41 normozoospermic, 29 asthenozoospermic, 35 oligoasthenozoospermic, 34 azoospermic)	Male infertility	DAO
2508450	Male infertility, sperm motility				Male infertility	DAO
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)