• Gene id: 1609

Gene Summary

• Gene Symbol: DGKQ   Gene   UCSC   Ensembl
• Aliases: DAGK, DAGK4, DAGK7
• Gene name: diacylglycerol kinase theta
• Alternate names: diacylglycerol kinase theta, DAG kinase theta, DGK-theta, diacylglycerol kinase, theta 110kDa, diglyceride kinase theta, testis tissue sperm-binding protein Li 38a,
• Gene location: 4p16.3 (973568: 958886)     Exons: 25     NC_000004.12
• Gene summary(Entrez): The protein encoded by this gene contains three cysteine-rich domains, a proline-rich region, and a pleckstrin homology domain with an overlapping Ras-associating domain. It is localized in the speckle domains of the nucleus, and mediates the regeneration

Protein Summary

• Protein general information: P52824  
  • Name: Diacylglycerol kinase theta (DAG kinase theta) (EC 2.7.1.107) (Diglyceride kinase theta) (DGK theta)
  • Length: 942  
  • Mass: 101155
• Sequence:

  MAAAAEPGARAWLGGGSPRPGSPACSPVLGSGGRARPGPGPGPGPERAGVRAPGPAAAPGHSFRKVTLTKPTFCH
  LCSDFIWGLAGFLCDVCNFMSHEKCLKHVRIPCTSVAPSLVRVPVAHCFGPRGLHKRKFCAVCRKVLEAPALHCE
  VCELHLHPDCVPFACSDCRQCHQDGHQDHDTHHHHWREGNLPSGARCEVCRKTCGSSDVLAGVRCEWCGVQAHSL
  CSAALAPECGFGRLRSLVLPPACVRLLPGGFSKTQSFRIVEAAEPGEGGDGADGSAAVGPGRETQATPESGKQTL
  KIFDGDDAVRRSQFRLVTVSRLAGAEEVLEAALRAHHIPEDPGHLELCRLPPSSQACDAWAGGKAGSAVISEEGR
  SPGSGEATPEAWVIRALPRAQEVLKIYPGWLKVGVAYVSVRVTPKSTARSVVLEVLPLLGRQAESPESFQLVEVA
  MGCRHVQRTMLMDEQPLLDRLQDIRQMSVRQVSQTRFYVAESRDVAPHVSLFVGGLPPGLSPEEYSSLLHEAGAT
  KATVVSVSHIYSSQGAVVLDVACFAEAERLYMLLKDMAVRGRLLTALVLPDLLHAKLPPDSCPLLVFVNPKSGGL
  KGRDLLCSFRKLLNPHQVFDLTNGGPLPGLHLFSQVPCFRVLVCGGDGTVGWVLGALEETRYRLACPEPSVAILP
  LGTGNDLGRVLRWGAGYSGEDPFSVLLSVDEADAVLMDRWTILLDAHEAGSAENDTADAEPPKIVQMSNYCGIGI
  DAELSLDFHQAREEEPGKFTSRLHNKGVYVRVGLQKISHSRSLHKQIRLQVERQEVELPSIEGLIFINIPSWGSG
  ADLWGSDSDTRFEKPRMDDGLLEVVGVTGVVHMGQVQGGLRSGIRIAQGSYFRVTLLKATPVQVDGEPWVQAPGH
  MIISAAGPKVHMLRKAKQKPRRAGTTRDARADAAPAPESDPR

• Structural information:
  • Protein Domains: (395..49-)
    (/note="Ras-associating-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00166-)
    (584..72-)
    (/note="DAGKc-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00783"-)
  • Interpro: IPR017438  IPR037607  IPR000756  IPR001206  IPR016064   IPR002219  IPR000159  IPR029071  
  • Prosite: PS50146 PS50200 PS00479 PS50081
  • CDD: cd00029
  • STRING: ENSP00000273814
• Other Databases: GeneCards:  DGKQ  Malacards:  DGKQ

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008277	regulation of G protein-coupled receptor signaling pathway	IDA	biological process
GO:0006654	phosphatidic acid biosynthetic process	IDA	biological process
GO:0006111	regulation of gluconeogenesis	IMP	biological process
GO:0004143	diacylglycerol kinase activity	IMP	molecular function
GO:0004143	diacylglycerol kinase activity	ISS	molecular function
GO:0005768	endosome	IDA	cellular component
GO:0012506	vesicle membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0030297	transmembrane receptor protein tyrosine kinase activator activity	IGI	molecular function
GO:0010801	negative regulation of peptidyl-threonine phosphorylation	IDA	biological process
GO:0006654	phosphatidic acid biosynthetic process	IMP	biological process
GO:0006654	phosphatidic acid biosynthetic process	IMP	biological process
GO:1903432	regulation of TORC1 signaling	IMP	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0016363	nuclear matrix	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0010801	negative regulation of peptidyl-threonine phosphorylation	IGI	biological process
GO:0090181	regulation of cholesterol metabolic process	IMP	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0018105	peptidyl-serine phosphorylation	IMP	biological process
GO:0019933	cAMP-mediated signaling	IMP	biological process
GO:2000064	regulation of cortisol biosynthetic process	IMP	biological process
GO:2000182	regulation of progesterone biosynthetic process	IMP	biological process
GO:0051591	response to cAMP	IDA	biological process
GO:0010629	negative regulation of gene expression	IMP	biological process
GO:0046339	diacylglycerol metabolic process	IBA	biological process
GO:0046486	glycerolipid metabolic process	IBA	biological process
GO:0046834	lipid phosphorylation	IBA	biological process
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0004143	diacylglycerol kinase activity	IBA	molecular function
GO:0019933	cAMP-mediated signaling	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0004143	diacylglycerol kinase activity	IDA	molecular function
GO:0006654	phosphatidic acid biosynthetic process	IDA	biological process
GO:0006654	phosphatidic acid biosynthetic process	IDA	biological process
GO:0004143	diacylglycerol kinase activity	IDA	molecular function
GO:0046834	lipid phosphorylation	IDA	biological process
GO:0046339	diacylglycerol metabolic process	IDA	biological process
GO:0046339	diacylglycerol metabolic process	IDA	biological process
GO:0046834	lipid phosphorylation	IDA	biological process
GO:0043274	phospholipase binding	IPI	molecular function
GO:0033613	activating transcription factor binding	IPI	molecular function
GO:0019900	kinase binding	IPI	molecular function
GO:0019900	kinase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003951	NAD+ kinase activity	IEA	molecular function
GO:0004143	diacylglycerol kinase activity	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0007205	protein kinase C-activating G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0004143	diacylglycerol kinase activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0030168	platelet activation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0098794	postsynapse	IEA	cellular component
GO:0016363	nuclear matrix	IEA	cellular component
GO:0004143	diacylglycerol kinase activity	IEA	molecular function
GO:1900242	regulation of synaptic vesicle endocytosis	IEA	biological process
GO:0098793	presynapse	IEA	cellular component
GO:0016607	nuclear speck	IEA	cellular component
GO:0004143	diacylglycerol kinase activity	IDA	molecular function
GO:0004143	diacylglycerol kinase activity	IDA	molecular function
GO:0046339	diacylglycerol metabolic process	IDA	biological process
GO:0046834	lipid phosphorylation	IDA	biological process
GO:0046339	diacylglycerol metabolic process	IDA	biological process
GO:0046486	glycerolipid metabolic process	IDA	biological process
GO:0046834	lipid phosphorylation	IDA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016607	nuclear speck	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007171	activation of transmembrane receptor protein tyrosine kinase activity	IEA	biological process
GO:0070493	thrombin-activated receptor signaling pathway	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0033198	response to ATP	IDA	biological process
GO:0016607	nuclear speck	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005856	cytoskeleton	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0070528	protein kinase C signaling	IDA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0004143	diacylglycerol kinase activity	IDA	molecular function
GO:0004143	diacylglycerol kinase activity	IDA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04072	Phospholipase D signaling pathway
hsa04070	Phosphatidylinositol signaling system
hsa00564	Glycerophospholipid metabolism
hsa05231	Choline metabolism in cancer
hsa00561	Glycerolipid metabolism

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq