• Gene id: 160857

Gene Summary

• Gene Symbol: CCDC122   Gene   UCSC   Ensembl
• Gene name: coiled-coil domain containing 122
• Alternate names: coiled-coil domain-containing protein 122,
• Gene location: 13q14.11 (43880022: 43821958)     Exons: 8     NC_000013.11
• Gene summary(Entrez): This gene encodes a protein that contains a coiled-coil domain. Naturally occurring mutations in this gene are associated with leprosy. [provided by RefSeq, Apr 2017]
• OMIM: 613408

Protein Summary

• Protein general information: Q5T0U0  
  • Name: Coiled coil domain containing protein 122
  • Length: 273  
  • Mass: 32206
• Sequence:

  MSDNKERKSQGFPKEDNQDTSSLADAVEKVAKQQQSQASEIEKNKKVLFNLKNELHELEKEIAAISAETKETERQ
  IYQQDSAIENTKLHCDSLETQIKSLHSENVKLKFDIETAQEDFEEHMIKYNAYYAKIKAHKNSLGEVESKWSFMT
  ELHEKRDFVKKLKTMKEELMQDLQNPGGNRITQVQEDITNLKDKIITVKESIIEKTCFLEEEKKTHEKLRKEIEV
  QHKRYDAILKRLHCQVNKLQSNRRQWQWNIQQLEKTAAELRKCIGMQE

• Structural information:
  • Interpro: IPR039998  
  • STRING: ENSP00000407763
• Other Databases: GeneCards:  CCDC122  Malacards:  CCDC122

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)