• Gene id: 160728

Gene Summary

• Gene Symbol: SLC5A8   Gene   UCSC   Ensembl
• Aliases: AIT, SMCT, SMCT1
• Gene name: solute carrier family 5 member 8
• Alternate names: sodium-coupled monocarboxylate transporter 1, apical iodide transporter, electrogenic sodium monocarboxylate cotransporter, sodium iodide-related cotransporter, solute carrier family 5 (iodide transporter), member 8, solute carrier family 5 (sodium/monocarboxy,
• Gene location: 12q23.1-q23.2 (101210237: 101155492)     Exons: 17     NC_000012.12
• Gene summary(Entrez): SLC5A8 has been shown to transport iodide by a passive mechanism (Rodriguez et al., 2002 [PubMed 12107270]) and monocarboxylates and short-chain fatty acids by a sodium-coupled mechanism (Gopal et al., 2004 [PubMed 15322102]). In kidney, SLC5A8 functions
• OMIM: 608044

Protein Summary

• Protein general information: Q8N695  
  • Name: Sodium coupled monocarboxylate transporter 1 (Apical iodide transporter) (Electrogenic sodium monocarboxylate cotransporter) (Sodium iodide related cotransporter) (Solute carrier family 5 member 8)
  • Length: 610  
  • Mass: 66578
  • Tissue specificity: Expressed in normal thyroid, localized at the apical pole of thyroid cells facing the colloid lumen, but expression profoundly decreased in thyroid carcinomas. Expressed in normal colon but absent in colon aberrant crypt foci and colon
• Sequence:

  MDTPRGIGTFVVWDYVVFAGMLVISAAIGIYYAFAGGGQQTSKDFLMGGRRMTAVPVALSLTASFMSAVTVLGTP
  SEVYRFGAIFSIFAFTYFFVVVISAEVFLPVFYKLGITSTYEYLELRFNKCVRLCGTVLFIVQTILYTGIVIYAP
  ALALNQVTGFDLWGAVVATGVVCTFYCTLGGLKAVIWTDVFQVGIMVAGFASVIIQAVVMQGGISTILNDAYDGG
  RLNFWNFNPNPLQRHTFWTIIIGGTFTWTSIYGVNQSQVQRYISCKSRFQAKLSLYINLVGLWAILTCSVFCGLA
  LYSRYHDCDPWTAKKVSAPDQLMPYLVLDILQDYPGLPGLFVACAYSGTLSTVSSSINALAAVTVEDLIKPYFRS
  LSERSLSWISQGMSVVYGALCIGMAALASLMGALLQAALSVFGMVGGPLMGLFALGILVPFANSIGALVGLMAGF
  AISLWVGIGAQIYPPLPERTLPLHLDIQGCNSTYNETNLMTTTEMPFTTSVFQIYNVQRTPLMDNWYSLSYLYFS
  TVGTLVTLLVGILVSLSTGGRKQNLDPRYILTKEDFLSNFDIFKKKKHVLSYKSHPVEDGGTDNPAFNHIELNSD
  QSGKSNGTRL

• Structural information:
  • Interpro: IPR038377  IPR001734  IPR041992  
  • Prosite: PS50283
  • CDD: cd11519
  • STRING: ENSP00000445340
• Other Databases: GeneCards:  SLC5A8  Malacards:  SLC5A8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005343	organic acid:sodium symporter activity	IBA	molecular function
GO:0006814	sodium ion transport	IBA	biological process
GO:0015730	propanoate transport	IBA	biological process
GO:0015913	short-chain fatty acid import	IBA	biological process
GO:0015293	symporter activity	IBA	molecular function
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0006814	sodium ion transport	IEA	biological process
GO:0015293	symporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0006811	ion transport	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006811	ion transport	TAS	biological process
GO:0022803	passive transmembrane transporter activity	TAS	molecular function
GO:0034356	NAD biosynthesis via nicotinamide riboside salvage pathway	TAS	biological process
GO:0008028	monocarboxylic acid transmembrane transporter activity	TAS	molecular function
GO:0015913	short-chain fatty acid import	IEA	biological process
GO:0015730	propanoate transport	IEA	biological process
GO:0015636	short-chain fatty acid transmembrane transporter activity	IEA	molecular function
GO:0005343	organic acid:sodium symporter activity	IEA	molecular function
GO:0140161	monocarboxylate:sodium symporter activity	IEA	molecular function
GO:0015718	monocarboxylic acid transport	IEA	biological process
GO:0015552	propionate transmembrane transporter activity	IEA	molecular function
GO:0015129	lactate transmembrane transporter activity	IEA	molecular function
GO:0016324	apical plasma membrane	IEA	cellular component
GO:1903825	organic acid transmembrane transport	IEA	biological process
GO:1903825	organic acid transmembrane transport	IEA	biological process
GO:0035873	lactate transmembrane transport	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881