• Gene id: 1604

Gene Summary

• Gene Symbol: CD55   Gene   UCSC   Ensembl
• Aliases: CHAPLE, CR, CROM, DAF, TC
• Gene name: CD55 molecule (Cromer blood group)
• Alternate names: complement decay-accelerating factor, CD55 antigen, CD55 molecule, decay accelerating factor for complement (Cromer blood group), Cromer blood group antigen,
• Gene location: 1q32.2 (207321673: 207360965)     Exons: 15     NC_000001.11
• Gene summary(Entrez): This gene encodes a glycoprotein involved in the regulation of the complement cascade. Binding of the encoded protein to complement proteins accelerates their decay, thereby disrupting the cascade and preventing damage to host cells. Antigens present on t
• OMIM: 125240

Protein Summary

• Protein general information: P08174  
  • Name: Complement decay accelerating factor (CD antigen CD55)
  • Length: 381  
  • Mass: 41400
  • Tissue specificity: Expressed on the plasma membranes of all cell types that are in intimate contact with plasma complement proteins. It is also found on the surfaces of epithelial cells lining extracellular compartments, and variants of the molecule are
• Sequence:

  MTVARPSVPAALPLLGELPRLLLLVLLCLPAVWGDCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGE
  KDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLK
  WSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYC
  PAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPT
  TVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGSGTTSGTTRLLSGHTCFTLTGLLGTLV
  TMGLLT

• Structural information:
  • Protein Domains: (35..9-)
    (/note="Sushi-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00302-)
    (96..16-)
    (/note="Sushi-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00302-)
    (161..22-)
    (/note="Sushi-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00302-)
    (-)
  • Interpro: IPR035976  IPR000436  
  • Prosite: PS50923
  • CDD: cd00033
  • PDB: 1H03 1H04 1H2P 1H2Q 1M11 1NWV 1OJV 1OJW 1OJY 1OK1 1OK2 1OK3 1OK9 1UOT 1UPN 2C8I 2QZD 2QZF 2QZH 3IYP 3J24 5FOA 6ILJ 6ILK
  • PDBsum: 1H03 1H04 1H2P 1H2Q 1M11 1NWV 1OJV 1OJW 1OJY 1OK1 1OK2 1OK3 1OK9 1UOT 1UPN 2C8I 2QZD 2QZF 2QZH 3IYP 3J24 5FOA 6ILJ 6ILK
  • STRING: ENSP00000356030
• Other Databases: GeneCards:  CD55  Malacards:  CD55

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045916	negative regulation of complement activation	IMP	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0045087	innate immune response	IEA	biological process
GO:0001618	virus receptor activity	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0006958	complement activation, classical pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0030449	regulation of complement activation	IDA	biological process
GO:1903659	regulation of complement-dependent cytotoxicity	IDA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	TAS	biological process
GO:0030133	transport vesicle	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0030667	secretory granule membrane	TAS	cellular component
GO:0033116	endoplasmic reticulum-Golgi intermediate compartment membrane	TAS	cellular component
GO:0033116	endoplasmic reticulum-Golgi intermediate compartment membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0101003	ficolin-1-rich granule membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0030449	regulation of complement activation	TAS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0046718	viral entry into host cell	IEA	biological process
GO:0046718	viral entry into host cell	IEA	biological process
GO:2000563	positive regulation of CD4-positive, alpha-beta T cell proliferation	IDA	biological process
GO:0045916	negative regulation of complement activation	IDA	biological process
GO:0008289	lipid binding	IDA	molecular function
GO:0001618	virus receptor activity	IDA	molecular function
GO:0045121	membrane raft	IDA	cellular component
GO:0031664	regulation of lipopolysaccharide-mediated signaling pathway	IDA	biological process
GO:2000516	positive regulation of CD4-positive, alpha-beta T cell activation	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0007204	positive regulation of cytosolic calcium ion concentration	IDA	biological process
GO:0035743	CD4-positive, alpha-beta T cell cytokine production	IDA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0045730	respiratory burst	NAS	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04640	Hematopoietic cell lineage
hsa04610	Complement and coagulation cascades
hsa05416	Viral myocarditis

Diseases

Associated diseases	References
Complement regulatory protein defects	KEGG:H00106
Complement regulatory protein defects	KEGG:H00106
Prostate cancer	PMID:18288643
Prostate cancer	PMID:16533428
Breast cancer	PMID:15102687
Breast cancer	PMID:18676748
Endometrial adenocarcinoma	PMID:11506079
cervical cancer	PMID:9358772
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq