• Gene id: 1603

Gene Summary

• Gene Symbol: DAD1   Gene   UCSC   Ensembl
• Aliases: OST2
• Gene name: defender against cell death 1
• Alternate names: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1, DAD-1, oligosaccharyl transferase subunit DAD1, oligosaccharyltransferase 2 homolog, oligosaccharyltransferase subunit 2 (non-catalytic),
• Gene location: 14q11.2 (22589223: 22564906)     Exons: 3     NC_000014.9
• Gene summary(Entrez): DAD1, the defender against apoptotic cell death, was initially identified as a negative regulator of programmed cell death in the temperature sensitive tsBN7 cell line. The DAD1 protein disappeared in temperature-sensitive cells following a shift to the
• OMIM: 300033

Protein Summary

• Protein general information: P61803  
  • Name: Dolichyl diphosphooligosaccharide protein glycosyltransferase subunit DAD1 (Oligosaccharyl transferase subunit DAD1) (Defender against cell death 1) (DAD 1)
  • Length: 113  
  • Mass: 12497
• Sequence:

  MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFISCVGSFILAVCLRI
  QINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG

• Structural information:
  • Interpro: IPR003038  
  • PDB: 6S7O 6S7T
  • PDBsum: 6S7O 6S7T
  • STRING: ENSP00000250498
• Other Databases: GeneCards:  DAD1  Malacards:  DAD1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008250	oligosaccharyltransferase complex	IDA	is active in
GO:0008047	enzyme activator activity	IMP	molecular function
GO:0006487	protein N-linked glycosylation	IMP	biological process
GO:0031647	regulation of protein stability	IMP	biological process
GO:0008250	oligosaccharyltransferase complex	TAS	cellular component
GO:0018279	protein N-linked glycosylation via asparagine	IC	biological process
GO:0008250	oligosaccharyltransferase complex	IBA	cellular component
GO:0006487	protein N-linked glycosylation	IBA	biological process
GO:0008250	oligosaccharyltransferase complex	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0018279	protein N-linked glycosylation via asparagine	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0001824	blastocyst development	IEA	biological process
GO:0007584	response to nutrient	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0043085	positive regulation of catalytic activity	IEA	biological process
GO:0006486	protein glycosylation	IEA	biological process
GO:0016020	membrane	HDA	cellular component
GO:0006486	protein glycosylation	ISS	biological process
GO:0008250	oligosaccharyltransferase complex	ISS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04141	Protein processing in endoplasmic reticulum
hsa00510	N-Glycan biosynthesis
hsa00513	Various types of N-glycan biosynthesis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray