• Gene id: 160140

Gene Summary

• Gene Symbol: C11orf65   Gene   UCSC   Ensembl
• Aliases: MFI
• Gene name: chromosome 11 open reading frame 65
• Alternate names: protein MFI, uncharacterized protein C11orf65, mitochondrial fission factor interactor,
• Gene location: 11q22.3 (108469831: 108308518)     Exons: 18     NC_000011.10
• OMIM: 605849

Protein Summary

• Protein general information: Q8NCR3  
  • Name: Protein MFI (Mitochondrial fission factor interactor)
  • Length: 313  
  • Mass: 36720
  • Tissue specificity: Enriched in the pancreatic beta cell and the testis and is expressed at low levels in other tissues tested. {ECO
• Sequence:

  MPWKEESEFTKQDKAARVIQQAWKSFLNVAIFQHFKSLIDLRRQGEPRQIVKYINPKEAELLDAAAGIHVRFRLG
  GVKFPPDIYYKIFTHRPIEDLCANSPRNYAKLPAKHTSHNKNDHLQEEDHSGWYHRIENNGWRPVSDTFWLSTDG
  MVVEDKKESEFHFSKLKRRQDLEKKRKLRKIEWMRQMYYSGSLEAKSTHHETLGLIHTATKGLIRAFEDGGIDSV
  MEWEVDEVLNWTNTLNFDEYIASWKEIATSNSSANFKGFRFNQAQKNIYNYGGDISKMQMGIPDDTYYENVYQEP
  NVTRLTPDSTYGL

• Structural information:
  • STRING: ENSP00000483537
• Other Databases: GeneCards:  C11orf65  Malacards:  C11orf65

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	ISS	cellular component
GO:0090258	negative regulation of mitochondrial fission	ISS	biological process
GO:0005741	mitochondrial outer membrane	ISS	cellular component
GO:1903215	negative regulation of protein targeting to mitochondrion	ISS	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1903215	negative regulation of protein targeting to mitochondrion	IEA	biological process
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0090258	negative regulation of mitochondrial fission	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray